SMPX Antibody

Images

 
Western Blot: SMPX Antibody [NBP1-53165] - Human Muscle lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMPX Antibody Summary

Immunogen
Synthetic peptides corresponding to SMPX(small muscle protein, X-linked) The peptide sequence was selected from the middle region of SMPX. Peptide sequence TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMPX
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SMPX and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SMPX Antibody

  • small muscle protein, X-linked
  • small muscular protein
  • SRMX
  • Stretch-responsive skeletal muscle protein

Background

SMPX plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4079
Species: Hu
Applications: WB, ICC
NBP1-59312
Species: Hu
Applications: WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33638
Species: Hu, Mu
Applications: WB, ICC/IF
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
355-BM/CF
Species: Hu, Mu, Rt
NBP1-82952
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP

Publications for SMPX Antibody (NBP1-53165) (0)

There are no publications for SMPX Antibody (NBP1-53165).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMPX Antibody (NBP1-53165) (0)

There are no reviews for SMPX Antibody (NBP1-53165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMPX Antibody (NBP1-53165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMPX Products

SMPX NBP1-53165

Bioinformatics Tool for SMPX Antibody (NBP1-53165)

Discover related pathways, diseases and genes to SMPX Antibody (NBP1-53165). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMPX Antibody (NBP1-53165)

Discover more about diseases related to SMPX Antibody (NBP1-53165).
 

Pathways for SMPX Antibody (NBP1-53165)

View related products by pathway.

PTMs for SMPX Antibody (NBP1-53165)

Learn more about PTMs related to SMPX Antibody (NBP1-53165).

Blogs on SMPX

There are no specific blogs for SMPX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMPX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMPX
Uniprot