SMN Recombinant Protein Antigen

Images

 
There are currently no images for SMN Recombinant Protein Antigen (NBP3-17675PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SMN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMN

Source: E. coli

Amino Acid Sequence: IDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17675.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMN Recombinant Protein Antigen

  • Gemin-1
  • Kugelberg-Welander disease)
  • SMNC
  • survival motor neuron protein
  • survival of motor neuron 1, telomeric

Background

SMN (Gemin 1) is the central component of a large oligomeric complex (SMN complex), including Gemins 2-7, that is necessary and sufficient for the in vivo assembly of Sm proteins onto the small nuclear (sn)RNAs that mediate pre-mRNA splicing. The SMN complex is found in the cytoplasm and nucleus. Within the nucleus, this protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). Spinal muscular atrophy, a motor neuron disorder, results from reduced levels or a mutation in the Gemin 1 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF829
Species: Hu
Applications: WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-52454
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-672
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
NBP1-82991
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-20521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-62651
Species: Hu
Applications: IHC,  IHC-P, WB
AF1436
Species: Mu
Applications: WB
NB100-55266
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-83280
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NB300-269
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KD, WB
233-FB
Species: Hu
Applications: BA
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA

Publications for SMN Recombinant Protein Antigen (NBP3-17675PEP) (0)

There are no publications for SMN Recombinant Protein Antigen (NBP3-17675PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMN Recombinant Protein Antigen (NBP3-17675PEP) (0)

There are no reviews for SMN Recombinant Protein Antigen (NBP3-17675PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMN Recombinant Protein Antigen (NBP3-17675PEP). (Showing 1 - 1 of 1 FAQ).

  1. Could you recommond the Human specific SMN antibody? It will only recognize human SMN, without cross reaction with mouse smn.
    • We do not have an SMN antibody that has been validated NOT to work in mouse samples. When an antibody is found to not react with a certain species, we mark the data sheet with a (-) next to the species' name. Unfortunately, the SMN antibodies that do not list mouse have not been tested in mouse, and may react.

Additional SMN Products

Research Areas for SMN Recombinant Protein Antigen (NBP3-17675PEP)

Find related products by research area.

Blogs on SMN

There are no specific blogs for SMN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SMN1