Smek1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Smek1 Antibody [NBP1-84664] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Smek1 Antibody [NBP1-84664] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Smek1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMEK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Smek1 Protein (NBP1-84664PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Smek1 Antibody

  • FLFL1
  • FLJ20707
  • KIAA2010MSTP033
  • PP4R3A
  • PPP4R3A
  • serine/threonine-protein phosphatase 4 regulatory subunit 3A
  • SMEK homolog 1
  • SMEK homolog 1, suppressor of mek1 (Dictyostelium)
  • smk1
  • smk-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
MAB5074
Species: Hu
Applications: WB
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89958
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83882
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA

Publications for Smek1 Antibody (NBP1-84664) (0)

There are no publications for Smek1 Antibody (NBP1-84664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smek1 Antibody (NBP1-84664) (0)

There are no reviews for Smek1 Antibody (NBP1-84664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Smek1 Antibody (NBP1-84664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Smek1 Products

Bioinformatics Tool for Smek1 Antibody (NBP1-84664)

Discover related pathways, diseases and genes to Smek1 Antibody (NBP1-84664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smek1 Antibody (NBP1-84664)

Discover more about diseases related to Smek1 Antibody (NBP1-84664).
 

Pathways for Smek1 Antibody (NBP1-84664)

View related products by pathway.

PTMs for Smek1 Antibody (NBP1-84664)

Learn more about PTMs related to Smek1 Antibody (NBP1-84664).

Blogs on Smek1

There are no specific blogs for Smek1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smek1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMEK1