We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SMC6L1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related SMC6L1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-55146PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SMC6L1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to SMC6L1.

Source: E. coli

Amino Acid Sequence: ADERVLQALMKRFYLPGTSRPPIIVSEFRNEIYDVRHRAAYHPDFPTVLTALEIDNAVVANSLIDMRGIETVLLIKNNSVARAVMQSQKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMC6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55146.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMC6L1 Recombinant Protein Antigen

  • FLJ22116
  • hSMC6
  • SMC protein 6
  • SMC6 structural maintenance of chromosomes 6-like 1 (yeast)
  • SMC6 structural maintenance of chromosomes 6-like 1
  • SMC-6
  • SMC6L1FLJ35534
  • structural maintenance of chromosomes 6
  • structural maintenance of chromosomes protein 6

Background

SMC (Structural maintenance of chromosomes) proteins are members of multisubunit complexes that play a critical role in chromosome organization, segregation, gene regulation, and DNA repair. Two of these complexes, cohesin and condensin consist of a core complex of an SMC1 and SMC3 heterodimer or an SMC2 and SMC4 heterodimer, respectively. A third complex includes a heterodimer of SMC5 and SMC6 whose function is not fully understood but is proposed to be related to DNA repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-469
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-76263
Species: Hu, Mu, Rt
Applications: ELISA, WB
H00056852-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-14006
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92201
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-03263
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-204
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB100-373
Species: Hu
Applications: ICC/IF, IP, KD, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD
NBP1-86635
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80665
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-13942
Species: Hu
Applications: IHC,  IHC-P
H00056160-M02-100ug
Species: Hu
Applications: ELISA, WB
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00084901-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB

Publications for SMC6L1 Recombinant Protein Antigen (NBP2-55146PEP) (0)

There are no publications for SMC6L1 Recombinant Protein Antigen (NBP2-55146PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMC6L1 Recombinant Protein Antigen (NBP2-55146PEP) (0)

There are no reviews for SMC6L1 Recombinant Protein Antigen (NBP2-55146PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMC6L1 Recombinant Protein Antigen (NBP2-55146PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMC6L1 Products

Research Areas for SMC6L1 Recombinant Protein Antigen (NBP2-55146PEP)

Find related products by research area.

Blogs on SMC6L1

There are no specific blogs for SMC6L1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMC6L1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SMC6