Recombinant Human SMC6L1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SMC6L1 Protein Summary

Description
SMC6L1 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFV
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SMC6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMC6L1 Protein

  • FLJ22116
  • hSMC6
  • SMC protein 6
  • SMC6 structural maintenance of chromosomes 6-like 1 (yeast)
  • SMC6 structural maintenance of chromosomes 6-like 1
  • SMC-6
  • SMC6L1FLJ35534
  • structural maintenance of chromosomes 6
  • structural maintenance of chromosomes protein 6

Background

SMC6L1 - SMC6 structural maintenance of chromosomes 6-like 1 (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-469
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-42643
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03263
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-204
Species: Hu, Mu, Xp
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NB100-373
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP1-86635
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80665
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55368
Species: Hu
Applications: ICC/IF
NBP1-79687
Species: Hu
Applications: WB
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00084901-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SMC6L1 Partial Recombinant Protein (H00079677-Q01) (0)

There are no publications for SMC6L1 Partial Recombinant Protein (H00079677-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMC6L1 Partial Recombinant Protein (H00079677-Q01) (0)

There are no reviews for SMC6L1 Partial Recombinant Protein (H00079677-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMC6L1 Partial Recombinant Protein (H00079677-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMC6L1 Products

Bioinformatics Tool for SMC6L1 Partial Recombinant Protein (H00079677-Q01)

Discover related pathways, diseases and genes to SMC6L1 Partial Recombinant Protein (H00079677-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMC6L1 Partial Recombinant Protein (H00079677-Q01)

Discover more about diseases related to SMC6L1 Partial Recombinant Protein (H00079677-Q01).
 

Pathways for SMC6L1 Partial Recombinant Protein (H00079677-Q01)

View related products by pathway.

PTMs for SMC6L1 Partial Recombinant Protein (H00079677-Q01)

Learn more about PTMs related to SMC6L1 Partial Recombinant Protein (H00079677-Q01).
 

Research Areas for SMC6L1 Partial Recombinant Protein (H00079677-Q01)

Find related products by research area.

Blogs on SMC6L1

There are no specific blogs for SMC6L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SMC1 Antibody
NB100-204
SMC1 Antibody
NB100-204
SMC1 Antibody
NB100-204
SMC6L1 Antibody (2E6)
H00079677-M01
SMC6L1 Antibody (2E6)
H00079677-M01
SMC6L1 Antibody (2E6)
H00079677-M01
RAD18 Antibody (3H7)
H00056852-M01
RAD18 Antibody (3H7)
H00056852-M01
RAD18 Antibody (3H7)
H00056852-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMC6L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMC6