SMC3 Antibody

Images

 
Genetic Strategies: Western Blot: SMC3 Antibody [NBP2-58330] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SMC3 antibody. Remaining relative intensity ...read more
Immunocytochemistry/ Immunofluorescence: SMC3 Antibody [NBP2-58330] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

SMC3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQM
Specificity
Specificity of human SMC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMC3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMC3 Recombinant Protein Antigen (NBP2-58330PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SMC3 Antibody

  • Bamacan
  • BAMSMC protein 3
  • Basement membrane-associated chondroitin proteoglycan
  • BMH
  • chondroitin sulfate proteoglycan 6 (bamacan)
  • Chondroitin sulfate proteoglycan 6
  • Chromosome-associated polypeptide
  • CSPG6structural maintenance of chromosomes protein 3
  • hCAP
  • HCAPbamacan
  • SMC-3
  • SMC3L1CDLS3
  • structural maintenance of chromosomes 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NB100-204
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20053
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20497
Species: Hu
Applications: WB, IHC, IHC-P
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP1-52168
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87144
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-232
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for SMC3 Antibody (NBP2-58330) (0)

There are no publications for SMC3 Antibody (NBP2-58330).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMC3 Antibody (NBP2-58330) (0)

There are no reviews for SMC3 Antibody (NBP2-58330). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMC3 Antibody (NBP2-58330) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMC3 Products

Bioinformatics Tool for SMC3 Antibody (NBP2-58330)

Discover related pathways, diseases and genes to SMC3 Antibody (NBP2-58330). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMC3 Antibody (NBP2-58330)

Discover more about diseases related to SMC3 Antibody (NBP2-58330).
 

Pathways for SMC3 Antibody (NBP2-58330)

View related products by pathway.

PTMs for SMC3 Antibody (NBP2-58330)

Learn more about PTMs related to SMC3 Antibody (NBP2-58330).
 

Research Areas for SMC3 Antibody (NBP2-58330)

Find related products by research area.

Blogs on SMC3

There are no specific blogs for SMC3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMC3