SMC3 Antibody (8W9R7)

Western Blot: SMC3 Antibody (8W9R7) [NBP3-15798] - Western blot analysis of extracts of various cell lines, using SMC3 Rabbit mAb (NBP3-15798) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: SMC3 Antibody (8W9R7) [NBP3-15798] - Immunofluorescence analysis of C6 using SMC3 antibody (NBP3-15798) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: SMC3 Antibody (8W9R7) [NBP3-15798] - Immunofluorescence analysis of U2OS using SMC3 antibody (NBP3-15798) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: SMC3 Antibody (8W9R7) [NBP3-15798] - Immunofluorescence analysis of NIH/3T3 using SMC3 antibody (NBP3-15798) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunoprecipitation: SMC3 Antibody (8W9R7) [NBP3-15798] - Immunoprecipitation analysis of 300ug extracts of U-87MG cells using 3ug SMC3 antibody (NBP3-15798). Western blot was performed from the immunoprecipitate using SMC3 antibody (NBP3-15798) at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IP
• Clone: 8W9R7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SMC3 Antibody (8W9R7) Summary

• Description: Novus Biologicals Rabbit SMC3 Antibody (8W9R7) (NBP3-15798) is a recombinant monoclonal antibody validated for use in WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1). GQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SMC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMC3 Antibody (8W9R7)

• Bamacan
• BAMSMC protein 3
• Basement membrane-associated chondroitin proteoglycan
• BMH
• chondroitin sulfate proteoglycan 6 (bamacan)
• Chondroitin sulfate proteoglycan 6
• Chromosome-associated polypeptide
• CSPG6structural maintenance of chromosomes protein 3
• hCAP
• HCAPbamacan
• SMC-3
• SMC3L1CDLS3
• structural maintenance of chromosomes 3

Background

Involved in chromosome cohesion during cell cycle and in DNA repair. Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis and in chromosome movement.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMC3