SMC1L2 Antibody

Images

 
Western Blot: SMC1L2 Antibody [NBP2-85776] - Host: Rabbit. Target Name: SMC1B. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMC1L2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SMC1L2. Peptide sequence: RKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDVA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SMC1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMC1L2 Antibody

  • bK268H5
  • bK268H5.5
  • FLJ43748
  • mitosis-specific chromosome segregation protein like protein beta
  • SMC protein 1B
  • SMC1 (structural maintenance of chromosomes 1, yeast)-like 1
  • SMC1 structural maintenance of chromosomes 1-like 2 (yeast)
  • SMC1 structural maintenance of chromosomes 1-like 2
  • SMC-1B
  • SMC1BETA
  • SMC-1-beta
  • SMC1L2
  • structural maintenance of chromosomes 1B
  • structural maintenance of chromosomes protein 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB300-232
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-204
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-87144
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-47258
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-94045
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-53169
Species: Hu
Applications: IHC, IHC-P, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
H00010735-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-87097
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-24590
Species: Mu
Applications: IHC, IHC-P, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-87396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
DFN00
Species: Hu
Applications: ELISA
NBP2-85776
Species: Hu
Applications: WB

Publications for SMC1L2 Antibody (NBP2-85776) (0)

There are no publications for SMC1L2 Antibody (NBP2-85776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMC1L2 Antibody (NBP2-85776) (0)

There are no reviews for SMC1L2 Antibody (NBP2-85776). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMC1L2 Antibody (NBP2-85776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMC1L2 Products

Bioinformatics Tool for SMC1L2 Antibody (NBP2-85776)

Discover related pathways, diseases and genes to SMC1L2 Antibody (NBP2-85776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMC1L2 Antibody (NBP2-85776)

Discover more about diseases related to SMC1L2 Antibody (NBP2-85776).
 

Pathways for SMC1L2 Antibody (NBP2-85776)

View related products by pathway.

Research Areas for SMC1L2 Antibody (NBP2-85776)

Find related products by research area.

Blogs on SMC1L2

There are no specific blogs for SMC1L2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMC1L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMC1B