STAG3 Antibody - BSA Free

Western Blot: STAG3 Antibody [NBP1-58087] - Western blot of 20 ug whole cell testis lysate.Primary Antibody: 1 : 1,000 overnight at 4 C. This image was submitted by customer review.

Western Blot: STAG3 Antibody [NBP1-58087] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

STAG3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to STAG3(stromal antigen 3) The peptide sequence was selected from the middle region of STAG3. Peptide sequence VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: SA-3.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAG3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for STAG3 Antibody - BSA Free

• cohesin subunit SA-3
• SCC3 homolog 3
• stromal antigen 3stromalin 3
• stromalin-3

Background

STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for STAG3 Antibody (NBP1-58087) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Karen Berkowitz WB Mouse 01/29/2018

Summary

• Application: Western Blot
• Sample Tested: 20 ug whole cell testis lysate
• Species: Mouse
• Lot: QC22012

Comments

• Comments: Blocking: 5% Milk/PBS for 1 hour
  Primary Antibody: 1 : 1,000 overnight at 4° C

Bioinformatics

• Gene Symbol: STAG3
• Uniprot:
  • Q9UJ98(Human)