SMAP1 Antibody - Azide and BSA Free

Western Blot: SMAP1 Antibody [H00060682-B01P] - Analysis of SMAP1 expression in K-562.

Western Blot: SMAP1 Antibody [H00060682-B01P] - Analysis of SMAP1 expression in HeLa.

Western Blot: SMAP1 Antibody [H00060682-B01P] - Analysis of SMAP1 expression in transfected 293T cell line by SMAP1 polyclonal antibody. Lane 1: SMAP1 transfected lysate(48.4 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SMAP1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SMAP1 Antibody - Azide and BSA Free (H00060682-B01P) is a polyclonal antibody validated for use in WB. Anti-SMAP1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SMAP1 (NP_068759.2, 1 a.a. - 440 a.a.) full-length human protein. MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWK
• Specificity: SMAP1 - stromal membrane-associated protein 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SMAP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMAP1 Antibody - Azide and BSA Free

• FLJ13159
• FLJ42245
• small ArfGAP 1
• SMAP-1
• stromal membrane-associated GTPase-activating protein 1
• stromal membrane-associated protein 1

Background

The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMAP1 Antibody (H00060682-B01P)(2)

Publications using H00060682-B01P

• J Harms, SM Lüttgenau, C Emming, J Guske, K Weber, T Wagner, L Schowe, P Nedvetsky, MP Krahn Pals1 functions in redundancy with SMAP1 to inhibit Arf6 in order to prevent Rac1-dependent colorectal cancer cell migration and invasion Cancer Gene Therapy, 2022-12-09;0(0):. 2022-12-09 [PMID: 36494580]
• Sangar F, Schreurs AS, Umana-Diaz C et al. Involvement of small ArfGAP1 (SMAP1), a novel Arf6-specific GTPase-activating protein, in microsatellite instability oncogenesis. Oncogene 2014-05-22 [PMID: 23752192] (WB)

Bioinformatics

• Gene Symbol: SMAP1
• Entrez:
  • 60682(Human)
• Uniprot:
  • NP_068759.2(Human)