Smad4 Recombinant Protein Antigen

Images

 
There are currently no images for Smad4 Recombinant Protein Antigen (NBP3-05507PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Smad4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Smad4.

Source: E. coli

Amino Acid Sequence: AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMAD4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05507.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Smad4 Recombinant Protein Antigen

  • DPC4
  • DPC4SMAD, mothers against DPP homolog 4 (Drosophila)
  • hSMAD4
  • JIP
  • MAD homolog 4
  • MADH4
  • MADH4mothers against decapentaplegic homolog 4
  • mothers against decapentaplegic homolog 4
  • mothers against decapentaplegic, Drosophila, homolog of, 4
  • SMAD 4
  • SMAD family member 4MAD, mothers against decapentaplegic homolog 4 (Drosophila)
  • SMAD, mothers against DPP homolog 4
  • Smad4

Background

Smad proteins, the mammalian homologs of the Drosophila Mothers against dpp (Mad) have been implicated as downstream effectors of TGFbeta/BMP signaling. Smad1 (also designated Madr1 or JV4-1), Smad5 and mammalian Smad8 (also designated Smad9 or MadH6) are effectors of BMP2 and BMP4 function while Smad2 (also designated Madr2 or JV18-1) and Smad3 are involved in TGFbeta and activin-mediated growth modulation. Smad4 (also designated DPC4) has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/TGFbeta signaling by interfering with TGFbeta-mediated phosphorylation of other Smad family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7754-BH/CF
Species: Hu
Applications: BA
MAB2029
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF3025
Species: Hu
Applications: ELISA, ICC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-67394
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP3-05507PEP
Species: Hu
Applications: AC

Publications for Smad4 Recombinant Protein Antigen (NBP3-05507PEP) (0)

There are no publications for Smad4 Recombinant Protein Antigen (NBP3-05507PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad4 Recombinant Protein Antigen (NBP3-05507PEP) (0)

There are no reviews for Smad4 Recombinant Protein Antigen (NBP3-05507PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Smad4 Recombinant Protein Antigen (NBP3-05507PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Smad4 Products

Research Areas for Smad4 Recombinant Protein Antigen (NBP3-05507PEP)

Find related products by research area.

Blogs on Smad4

There are no specific blogs for Smad4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Smad4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD4