Smad2 Antibody - BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad2 (NP_005892.1). MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SMAD2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50-1:200
- Immunohistochemistry-Paraffin
- Knockout Validated
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Smad2 Antibody - BSA Free
Background
Smad 2 is a member of the Mothers Against Dpp (MAD)-related family of proteins. So far, nine Smads have been identified and can be divided in 3 subgroups based on their structure and functions; pathway-restricted, common mediator and inhibitory Smad. Smad 2 and 3 serve as pathway-restricted Smads for the TGF-beta/activin signaling pathways (1-2). Smad 2 is phosphorylated by the TGF-beta type 1 receptor kinase on Ser 465 and Ser 467. Phosphorylation of both serines is essential for Smad 2-Smad4 heteromeric complex and dissociation of Smad 2 from the TGF-beta type 1 receptor (3). Once phosphorylated Smad2 translocate to the nucleus where it associates with DNA-binding proteins and forming a transcriptional complex (4). Unlike Smad 3 and 4, Smad 2 does not directly bind DNA (5).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Publications for Smad2 Antibody (NBP3-02957) (0)
There are no publications for Smad2 Antibody (NBP3-02957).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Smad2 Antibody (NBP3-02957) (0)
There are no reviews for Smad2 Antibody (NBP3-02957).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Smad2 Antibody (NBP3-02957) (0)