Recombinant Human SLURP1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLURP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-103 of Human SLURP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SLURP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00057152-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLURP1 Protein

  • ANUPARS(component B)-81/S
  • ARS Component B
  • ArsB
  • ARSlymphocyte antigen 6-like secreted
  • LY6LS
  • MDMsecreted Ly-6/uPAR-related protein 1
  • neoplastic urinary protein
  • secreted LY6/PLAUR domain containing 1
  • secreted Ly6/uPAR related protein 1
  • SLURP1
  • SLURP-1

Background

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP2-75563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
6507-IL/CF
Species: Hu
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00057152-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SLURP1 Recombinant Protein (H00057152-P01)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLURP1 Recombinant Protein (H00057152-P01) (0)

There are no reviews for SLURP1 Recombinant Protein (H00057152-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLURP1 Recombinant Protein (H00057152-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SLURP1 Recombinant Protein (H00057152-P01)

Discover related pathways, diseases and genes to SLURP1 Recombinant Protein (H00057152-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLURP1 Recombinant Protein (H00057152-P01)

Discover more about diseases related to SLURP1 Recombinant Protein (H00057152-P01).
 

Pathways for SLURP1 Recombinant Protein (H00057152-P01)

View related products by pathway.

PTMs for SLURP1 Recombinant Protein (H00057152-P01)

Learn more about PTMs related to SLURP1 Recombinant Protein (H00057152-P01).
 

Research Areas for SLURP1 Recombinant Protein (H00057152-P01)

Find related products by research area.

Blogs on SLURP1

There are no specific blogs for SLURP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4
6507-IL-010/CF
SLURP1 Antibody
NBP2-13351

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLURP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLURP1
Entrez