SLMAP Antibody

Images

 
Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SLMAP Antibody [NBP1-81397] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry: SLMAP Antibody [NBP1-81397] - Immunohistochemistry analysis in human smooth muscle and liver tissues using Anti-SLMAP antibody. Corresponding SLMAP RNA-seq data are presented for the same tissues.
Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in human cell line CAPAN-2.
Independent Antibodies: Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver, lymph node, smooth muscle and testis using Anti-SLMAP antibody NBP1-81397 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human testis.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver using Anti-SLMAP antibody NBP1-81397.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human smooth muscle using Anti-SLMAP antibody NBP1-81397.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

SLMAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ
Specificity
Specificity of human, mouse, rat SLMAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLMAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLMAP Protein (NBP1-81397PEP)
Publications
Read Publication using
NBP1-81397 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30934005).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLMAP Antibody

  • FLJ42206
  • KIAA1601Sarcolemmal-associated protein
  • MGC138760
  • sarcolemma associated protein
  • sarcolemmal membrane-associated protein
  • SLAPMGC138761

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80744
Species: Hu
Applications: IHC, IHC-P
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
AF3857
Species: Hu
Applications: WB
NBP2-74210
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-44502
Species: Hu
Applications: Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NB300-996
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-00289
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-CS
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81397
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLMAP Antibody (NBP1-81397)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for SLMAP Antibody (NBP1-81397) (0)

There are no reviews for SLMAP Antibody (NBP1-81397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLMAP Antibody (NBP1-81397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLMAP Products

Bioinformatics Tool for SLMAP Antibody (NBP1-81397)

Discover related pathways, diseases and genes to SLMAP Antibody (NBP1-81397). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLMAP Antibody (NBP1-81397)

Discover more about diseases related to SLMAP Antibody (NBP1-81397).
 

Pathways for SLMAP Antibody (NBP1-81397)

View related products by pathway.

PTMs for SLMAP Antibody (NBP1-81397)

Learn more about PTMs related to SLMAP Antibody (NBP1-81397).

Blogs on SLMAP

There are no specific blogs for SLMAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLMAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLMAP