SLK Antibody - BSA Free

Staining of human cell line A-431 shows localization to cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLK Antibody - BSA Free (NBP3-25147) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein SLK using the following amino acid sequence: KEPEVTVVSQPTEPQPVLIPSININSDSGENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSFLSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLK Antibody - BSA Free

• bA16H23.1
• CTCL tumor antigen se20-9
• EC 2.7.11
• EC 2.7.11.1
• hSLK
• KIAA0204LOSK
• Long Ste20-like Kinase
• se20-9
• Serine/threonine-protein kinase 2
• SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrosenonfermenting like kinase (yeast)
• SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrosenonfermenting like kinase
• SNF1 sucrose nonfermenting like kinase
• STE20-like kinaseSTE20-like kinase (yeast)
• STE20-like serine/threonine-protein kinase
• STE20-related kinase
• Ste20-related serine/threonine kinase
• STE20-related serine/threonine-protein kinase
• STK2MGC133067

Background

The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene was only detected in retina and brain. Study of the mouse homolog demonstrated that groups of cells expressing this protein are located in the center or inner border of the inner unclear layer of retina. Three alternatively spliced variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLK