HOXB8 Antibody

Images

 
Western Blot: HOXB8 Antibody [NBP2-83058] - WB Suggested Anti-HOXB8 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Liver
Western Blot: HOXB8 Antibody [NBP2-83058] - Host: Rabbit. Target Name: HOXB8. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXB8 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human HOXB8. Peptide sequence: MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQH The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
HOXB8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXB8 Antibody

  • homeo box 2D
  • homeo box B8
  • homeobox B8
  • Homeobox protein Hox-2.4
  • Homeobox protein Hox-2D
  • homeobox protein Hox-B8
  • HOX2
  • HOX2DHox-2.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

203-IL/CF
Species: Hu
Applications: BA
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
H00003216-M01-100ug
Species: Hu
Applications: ELISA, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
H00003215-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
1845-SH/CF
Species: Hu
Applications: BA
H00003219-M05
Species: Hu
Applications: ChIP, ELISA, IP, S-ELISA, WB
NBP3-06103
Species: Hu
Applications: Flow, IHC, IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32356
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-85076
Species: Hu
Applications: WB
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for HOXB8 Antibody (NBP2-83058) (0)

There are no publications for HOXB8 Antibody (NBP2-83058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB8 Antibody (NBP2-83058) (0)

There are no reviews for HOXB8 Antibody (NBP2-83058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB8 Antibody (NBP2-83058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXB8 Products

Bioinformatics Tool for HOXB8 Antibody (NBP2-83058)

Discover related pathways, diseases and genes to HOXB8 Antibody (NBP2-83058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB8 Antibody (NBP2-83058)

Discover more about diseases related to HOXB8 Antibody (NBP2-83058).
 

Pathways for HOXB8 Antibody (NBP2-83058)

View related products by pathway.

PTMs for HOXB8 Antibody (NBP2-83058)

Learn more about PTMs related to HOXB8 Antibody (NBP2-83058).

Blogs on HOXB8

There are no specific blogs for HOXB8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB8