HOXB8 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human HOXB8. Peptide sequence: MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQH The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HOXB8 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for HOXB8 Antibody
Background
HOXB8 is 243 amino acids long, weighing approximately 27.5 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. Current studies are being done on several diseases and disorders including colorectal cancer, neuroblastoma, and neuronitis. HOXB8 has also been shown to have interactions with MEIS1, PBX2, PBX1, PBX3, and ASB1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu
Applications: PEP-ELISA, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Pm
Applications: WB
Species: Mu
Applications: BA
Species: Hu
Applications: ChIP, ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for HOXB8 Antibody (NBP2-83058) (0)
There are no publications for HOXB8 Antibody (NBP2-83058).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HOXB8 Antibody (NBP2-83058) (0)
There are no reviews for HOXB8 Antibody (NBP2-83058).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HOXB8 Antibody (NBP2-83058) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HOXB8 Products
Bioinformatics Tool for HOXB8 Antibody (NBP2-83058)
Discover related pathways, diseases and genes to HOXB8 Antibody (NBP2-83058). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for HOXB8 Antibody (NBP2-83058)
Discover more about diseases related to HOXB8 Antibody (NBP2-83058).
| | Pathways for HOXB8 Antibody (NBP2-83058)
View related products by pathway.
|
PTMs for HOXB8 Antibody (NBP2-83058)
Learn more about PTMs related to HOXB8 Antibody (NBP2-83058).
|
Blogs on HOXB8