Slit3 Antibody

Immunocytochemistry/Immunofluorescence: Slit3 Antibody [NBP2-13350] - Staining of human cell line RT4 shows localization to cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Slit3 Antibody [NBP2-13350] - Staining of human duodenum shows strong cytoplasmic positivity in goblet cells.

Product Discontinued

Slit3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLG QVVREVIRRQKGYASCATASKVPIMECRG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLIT3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Slit3 Antibody

• KIAA0814
• MEGF5
• MEGF5Multiple epidermal growth factor-like domains protein 5
• Multiple EGF-like domains protein 5
• SLIL2
• SLIL2FLJ10764
• slit homolog 3 (Drosophila)
• slit homolog 3 protein
• SLIT1
• slit2
• Slit3
• Slit-3slit (Drosophila) homolog 3

Background

SLIT3 - slit homolog 3 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLIT3