Slit3 Antibody

Images

 
Western Blot: Slit3 Antibody [NBP2-13350] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Slit3 Antibody [NBP2-13350] - Staining of human cell line RT4 shows localization to cell junctions.
Immunohistochemistry-Paraffin: Slit3 Antibody [NBP2-13350] - Staining of human duodenum shows strong cytoplasmic positivity in goblet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Slit3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLG QVVREVIRRQKGYASCATASKVPIMECRG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLIT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Slit3 Protein (NBP2-13350PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Slit3 Antibody

  • KIAA0814
  • MEGF5
  • MEGF5Multiple epidermal growth factor-like domains protein 5
  • Multiple EGF-like domains protein 5
  • SLIL2
  • SLIL2FLJ10764
  • slit homolog 3 (Drosophila)
  • slit homolog 3 protein
  • SLIT1
  • slit2
  • Slit3
  • Slit-3slit (Drosophila) homolog 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1749
Species: Rt
Applications: WB, IHC
AF3147
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-58778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3155
Species: Mu
Applications: WB, IHC
AF844
Species: Mu
Applications: WB, Block
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
AF1166
Species: Mu
Applications: WB
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Slit3 Antibody (NBP2-13350) (0)

There are no publications for Slit3 Antibody (NBP2-13350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Slit3 Antibody (NBP2-13350) (0)

There are no reviews for Slit3 Antibody (NBP2-13350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Slit3 Antibody (NBP2-13350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Slit3 Products

Bioinformatics Tool for Slit3 Antibody (NBP2-13350)

Discover related pathways, diseases and genes to Slit3 Antibody (NBP2-13350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slit3 Antibody (NBP2-13350)

Discover more about diseases related to Slit3 Antibody (NBP2-13350).
 

Pathways for Slit3 Antibody (NBP2-13350)

View related products by pathway.

PTMs for Slit3 Antibody (NBP2-13350)

Learn more about PTMs related to Slit3 Antibody (NBP2-13350).
 

Research Areas for Slit3 Antibody (NBP2-13350)

Find related products by research area.

Blogs on Slit3

There are no specific blogs for Slit3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Slit3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLIT3
Entrez