Slit3 Antibody


Western Blot: Slit3 Antibody [NBP2-13350] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Slit3 Antibody [NBP2-13350] - Staining of human cell line RT4 shows localization to cell junctions.
Immunohistochemistry-Paraffin: Slit3 Antibody [NBP2-13350] - Staining of human duodenum shows strong cytoplasmic positivity in goblet cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Slit3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLG QVVREVIRRQKGYASCATASKVPIMECRG
Specificity of human Slit3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Slit3 Protein (NBP2-13350PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Slit3 Antibody

  • KIAA0814
  • MEGF5
  • MEGF5Multiple epidermal growth factor-like domains protein 5
  • Multiple EGF-like domains protein 5
  • SLIL2
  • SLIL2FLJ10764
  • slit homolog 3 (Drosophila)
  • slit homolog 3 protein
  • SLIT1
  • slit2
  • Slit3
  • Slit-3slit (Drosophila) homolog 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Rt
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Mu
Applications: WB, Block
Species: Hu, Pm
Applications: WB, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for Slit3 Antibody (NBP2-13350) (0)

There are no publications for Slit3 Antibody (NBP2-13350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Slit3 Antibody (NBP2-13350) (0)

There are no reviews for Slit3 Antibody (NBP2-13350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Slit3 Antibody (NBP2-13350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Slit3 Products

Bioinformatics Tool for Slit3 Antibody (NBP2-13350)

Discover related pathways, diseases and genes to Slit3 Antibody (NBP2-13350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slit3 Antibody (NBP2-13350)

Discover more about diseases related to Slit3 Antibody (NBP2-13350).

Pathways for Slit3 Antibody (NBP2-13350)

View related products by pathway.

PTMs for Slit3 Antibody (NBP2-13350)

Learn more about PTMs related to Slit3 Antibody (NBP2-13350).

Research Areas for Slit3 Antibody (NBP2-13350)

Find related products by research area.

Blogs on Slit3

There are no specific blogs for Slit3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Slit3 Antibody and receive a gift card or discount.


Gene Symbol SLIT3