SLC7A9 Antibody


Immunocytochemistry/ Immunofluorescence: SLC7A9 Antibody [NBP1-92409] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining in human kidney and lymph node tissues using anti-SLC7A9 antibody. Corresponding SLC7A9 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SLC7A9 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE
Specificity of human SLC7A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC7A9 Protein (NBP1-92409PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC7A9 Antibody

  • b(0,+)AT
  • b(0+)AT
  • B(0+)-type amino acid transporter 1
  • BAT1
  • bo+ amino acid transporter
  • CSNU3
  • FLJ94301
  • Glycoprotein-associated amino acid transporter b0+AT1
  • SLC7A9
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 9
  • Solute carrier family 7 member 9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
Species: Hu, Am, Bv, Ca, Eq, Pm
Applications: WB
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, ICC/IF

Publications for SLC7A9 Antibody (NBP1-92409) (0)

There are no publications for SLC7A9 Antibody (NBP1-92409).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A9 Antibody (NBP1-92409) (0)

There are no reviews for SLC7A9 Antibody (NBP1-92409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC7A9 Antibody (NBP1-92409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC7A9 Antibody (NBP1-92409)

Discover related pathways, diseases and genes to SLC7A9 Antibody (NBP1-92409). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A9 Antibody (NBP1-92409)

Discover more about diseases related to SLC7A9 Antibody (NBP1-92409).

Pathways for SLC7A9 Antibody (NBP1-92409)

View related products by pathway.

PTMs for SLC7A9 Antibody (NBP1-92409)

Learn more about PTMs related to SLC7A9 Antibody (NBP1-92409).

Blogs on SLC7A9.

The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC7A9 Antibody and receive a gift card or discount.


Gene Symbol SLC7A9