SLC7A9 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human kidney shows strong positivity in apical membrane in cells in proximal tubules.

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Analysis in human duodenum and pancreas tissues using NBP1-92409 antibody. Corresponding SLC7A9 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC7A9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC7A9 Antibody - BSA Free (NBP1-92409) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC7A9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC7A9 Protein (NBP1-92409PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC7A9 Antibody - BSA Free

• b(0,+)AT
• B(0+)AT
• B(0+)-type amino acid transporter 1
• BAT1
• bo+ amino acid transporter
• CSNU3
• FLJ94301
• Glycoprotein-associated amino acid transporter b0+AT1
• SLC7A9
• solute carrier family 7 (cationic amino acid transporter, y+ system), member 9
• Solute carrier family 7 member 9

Background

The SLC7A9 gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in t

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC7A9