SLC7A9 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Analysis in human duodenum and pancreas tissues using NBP1-92409 antibody. Corresponding SLC7A9 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human kidney shows strong positivity in apical membrane in cells in proximal tubules.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC7A9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE
Specificity
Specificity of human SLC7A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC7A9 Protein (NBP1-92409PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC7A9 Antibody

  • b(0,+)AT
  • b(0+)AT
  • B(0+)-type amino acid transporter 1
  • BAT1
  • bo+ amino acid transporter
  • CSNU3
  • FLJ94301
  • Glycoprotein-associated amino acid transporter b0+AT1
  • SLC7A9
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 9
  • Solute carrier family 7 member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-70344
Species: Hu, Am, Bv, Ca, Pm, Eq, Pm
Applications: WB
NBP2-00289
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-CS
NBP1-47989
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31356
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59857
Species: Hu
Applications: WB
NBP2-33471
Species: Hu
Applications: IHC, IHC-P
AF4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-75476
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82826
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-45072
Species: Hu
Applications: WB, ICC/IF, IP
NB300-318
Species: Hu, Mu, Rt
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Dual ISH-IHC
NBP2-22423
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, KO
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for SLC7A9 Antibody (NBP1-92409) (0)

There are no publications for SLC7A9 Antibody (NBP1-92409).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A9 Antibody (NBP1-92409) (0)

There are no reviews for SLC7A9 Antibody (NBP1-92409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC7A9 Antibody (NBP1-92409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC7A9 Products

Bioinformatics Tool for SLC7A9 Antibody (NBP1-92409)

Discover related pathways, diseases and genes to SLC7A9 Antibody (NBP1-92409). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A9 Antibody (NBP1-92409)

Discover more about diseases related to SLC7A9 Antibody (NBP1-92409).
 

Pathways for SLC7A9 Antibody (NBP1-92409)

View related products by pathway.

PTMs for SLC7A9 Antibody (NBP1-92409)

Learn more about PTMs related to SLC7A9 Antibody (NBP1-92409).

Blogs on SLC7A9.

The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A9