Home » SLC7A9 » SLC7A9 Antibodies » SLC7A9 Antibody

SLC7A9 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Analysis in human duodenum and pancreas tissues using NBP1-92409 antibody. Corresponding SLC7A9 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human kidney shows strong positivity in apical membrane in cells in proximal tubules.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SLC7A9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE
Specificity
Specificity of human SLC7A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC7A9 Protein (NBP1-92409PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC7A9 Antibody

  • b(0,+)AT
  • b(0+)AT
  • B(0+)-type amino acid transporter 1
  • BAT1
  • bo+ amino acid transporter
  • CSNU3
  • FLJ94301
  • Glycoprotein-associated amino acid transporter b0+AT1
  • SLC7A9
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 9
  • Solute carrier family 7 member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SLC3A1 Antibody
NBP2-47272
Western Blot: SLC3A1 Antibody [NBP2-47272] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: SLC3A1 Antibody [NBP2-47272] - Staining of human cervix, uterine shows low expression as expected.
Immunohistochemistry: SLC3A1 Antibody [NBP2-47272] - Staining of human kidney shows strong cytoplasmic and membrane positivity in cells in tubules.
Species: Hu
Applications: WB, IHC, IHC-P
CD98 Antibody
NBP2-47515
Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Analysis in human kidney and skeletal muscle tissues using NBP2-47515 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same tissues.
Western Blot: CD98 Antibody [NBP2-47515] - Analysis in human cell lines SK-MEL-30 and HEK293 using anti-SLC3A2 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: CD98 Antibody [NBP2-47515] - Staining of human cell line U-2 OS shows localization to nucleus, plasma membrane and cytosol.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
SLC7A5/LAT1
Antibody (BU53)
NBP2-50465
Immunohistochemistry-Paraffin: SLC7A5/LAT1 Antibody (BU53) [NBP2-50465] - Analysis of a FFPE tissue section of human testis using 1:200 dilution of SLC7A5/LAT1 (BU53) antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
Flow (Cell Surface): SLC7A5/LAT1 Antibody (BU53) [NBP2-50465] - A cell surface stain was performed on Raji cells with SLC7A5 (BU53) antibody NBP2-50465AF647 (blue) along with a matched isotype control NB600-986AF647 (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at RT. Both antibodies were conjugated to Alexa Fluor 647.
Flow (Cell Surface): SLC7A5/LAT1 Antibody (BU53) [NBP2-50465] - A cell surface stain was performed on Raji cells with SLC7A5 (BU53) antibody NBP2-50465 (blue) along with a matched isotype control NB600-986 (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at RT, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
(1 Publication)
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
MHC Class I
Antibody (OX18)
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC12 cells were fixed for 10 minutes using 4% PFA and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MHC Class I Antibody (OX18) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MHC Class I Antibody (OX18) [NB120-6405] - Analysis of FFPE rat brain cerebellum using MHC Class I (OK18) antibody at 1:200 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Endothelial staining was observed. Staining was performed by Histowiz.
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
(32 Publications)
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NFKBIL1 Antibody
NBP1-70344
Western Blot: NFKBIL1 Antibody [NBP1-70344] - analysis of NFKBIL1. Lanes 1 and 2 show HeLa cell lysate probed with pre-immune sera (1:5000) and NFKBIL1 polyclonal antibody (3 ug/ml), respectively.
Species: Hu, Am, Bv, Ca, Pm, Eq, Pm
Applications: WB
LAT Antibody
(LAT.10-17)
NBP2-00289
Western Blot: LAT Antibody (LAT.10-17) [NBP2-00289] - 10e6 normal peripheral human blood cells (lane 1), Jurkat (lane 2), and C57BL/6 splenocytes (lane 3) with 5 ug/mL Anti-Human LAT Purified. Bands were visualized using Anti-Mouse IgG HRP.
Immunohistochemistry-Paraffin: LAT Antibody (LAT.10-17) [NBP2-00289] - Staining of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 20 ug/ml.
Flow (Cell Surface): LAT Antibody (LAT.10-17) [NBP2-00289] - Analysis using the Allophycocyanin conjugate of NBP2-00289. Surface staining of normal human peripheral blood cells with Anti-Human CD3 FITC followed by intracellular staining with Mouse IgG1 kappa Isotype Control APC (left) or Anti-Human LAT APC (right).
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-CS
SLC7A8 Antibody
(OTI7D6)
NBP1-47989
Western Blot: SLC7A8 Antibody (7D6) [NBP1-47989] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SLC7A8 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SLC7A8.
Immunohistochemistry-Paraffin: SLC7A8 Antibody (7D6) [NBP1-47989] - Carcinoma of bladder tissue.
Immunohistochemistry-Paraffin: SLC7A8 Antibody (7D6) [NBP1-47989] - Staining of paraffin-embedded Adenocarcinoma of breast tissue using anti-SLC7A8 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Lymphotoxin
[Unconjugated]
8884-LY/CF
Lymphotoxin [Unconjugated]
(5 Publications)
Species: Hu
UAP56 Antibody
NBP1-31356
Western Blot: UAP56 Antibody [NBP1-31356] - UAP56 antibody detects UAP56 protein by western blot analysis. Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with UAP56 antibody diluted by 1:500. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: UAP56 Antibody [NBP1-31356] - UAP56 antibody [N1C2] detects UAP56 protein at nucleus by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: UAP56 protein stained by UAP56 antibody [N1C2] diluted at 1:500. Red: alpha Tubulin protein stained by alpha Tubulin antibody [GT114] diluted at 1:1000. Scale bar = 10 um.
Immunohistochemistry-Paraffin: UAP56 Antibody [NBP1-31356] - UAP56 antibody [N1C2] detects UAP56 protein at nucleus in mouse brain by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. UAP56 antibody [N1C2] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CAT1 Antibody
NBP1-59857
Western Blot: CAT1 Antibody [NBP1-59857] - Reccomended Titration: 1 ug/mL Sample Type: Human MDA-MB-435s
Western Blot: CAT1 Antibody [NBP1-59857] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: CAT1 Antibody [NBP1-59857] - Antibody Titration: 1 ug/ml Human 721_B.
Species: Hu
Applications: WB
BAT2 Antibody
NBP2-33471
Immunohistochemistry-Paraffin: BAT2 Antibody [NBP2-33471] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BAT2 Antibody [NBP2-33471] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BAT2 Antibody [NBP2-33471] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.
Species: Hu
Applications: IHC, IHC-P
NTAL Antibody
[Unconjugated]
AF4066
Western blot shows lysates of THP‑1 human acute monocytic leukemia cell line, Ramos human Burkitt's lymphoma cell line and Raji human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human NTAL Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4066) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for NTAL at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
THP‑1 human acute monocytic leukemia cell line was stained with Sheep Anti-Human NTAL Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF4066, filled histogram) or isotype control antibody (Catalog # 5-001-A, open histogram), followed by NorthernLights™ 637-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL011). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
EAAT3 Antibody
(JU39-69)
NBP2-75476
Western Blot: EAAT3 Antibody (JU39-69) [NBP2-75476] - Analysis of EAAT3 on mouse liver tissue lysate using anti-EAAT3 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: EAAT3 Antibody (JU39-69) [NBP2-75476] - Staining EAAT3 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: EAAT3 Antibody (JU39-69) [NBP2-75476] - Analysis of paraffin-embedded rat brain tissue using anti-EAAT3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SLC7A7 Antibody
NBP1-82826
Western Blot: SLC7A7 Antibody [NBP1-82826] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining in human kidney and prostate tissues using anti-SLC7A7 antibody. Corresponding SLC7A7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human kidney shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
HLA B Antibody
(2G7B10)
NBP2-61871
Western Blot: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis using HLA-B mAb against HEK293 (1) and HLA-B (AA: 241-362)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of Hela cells using HLA-B mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Goat anti-Mouse IgG (H+L) DyLight 488 secondary antibody was used.
Immunohistochemistry-Paraffin: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of bladder cancer tissues using HLA-B mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
LST1 Antibody
(LST1/02)
NBP1-45072
Western Blot: LST1 Antibody (LST1/02) [NBP1-45072] - Analysis (non-reducing conditions) of LST1 in whole cell lysate of U937 human Caucasian histiocytic lymphoma cell line. Lane 1: immunostaining with Isotype mouse IgG1 control (PPV-06) Lane 2-3: immunostaining with anti-human LST1 (LST1/02), two independent batches. Note: It migrates on SDS PAGE gels as approximately 25-28 kDa molecule.
Species: Hu
Applications: WB, ICC/IF, IP
xCT Antibody
NB300-318
Dual RNAscope ISH-IHC: xCT Antibody [NB300-318] - Formalin-fixed paraffin-embedded tissue sections of human stomach were probed for xCT mRNA (ACD RNAScope Probe, catalog #422688; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Rabbit Polyclonal (Novus Biologicals catalog # NB300-318) at 0.25ug/mL with 1 hour incubation at room temperature followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to glandular cells.
Simple Western: xCT Antibody [NB300-318] - Simple Western lane view shows a specific band for xCT using NB300-318 at 25 ug/ml in HeLa and HeLa + DEM cell lysates. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: xCT Antibody [NB300-318] - Western blot analysis of protein isolated from subcutaneous tumors derived from in vivo growth of the clones relative to WT-derived tumors revealed that xCT levels remained low, phospho-STAT5 (p-STAT5) levels remained high, and phospho-STAT3 (p-STAT3) levels remained unchanged in the absence of SH-4-54. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0161202), licensed under a CC-BY licence.
(3 Reviews)
(56 Publications)
Species: Hu, Mu, Rt
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Dual ISH-IHC
GIT1 Antibody
(S39B-8)
NBP2-22423
Western Blot: GIT1 Antibody (S39B-8) [NBP2-22423] - analysis of Rat brain membrane lysate showing detection of GIT1 protein using Mouse Anti-GIT1 Monoclonal Antibody, Clone S39B-8. Primary Antibody: Mouse Anti-GIT1 Monoclonal Antibody at 1:1000.
Immunocytochemistry/Immunofluorescence: GIT1 Antibody (S39B-8) [NBP2-22423] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-GIT1 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000; 1:5000 for 60 min RT, 5 min RT. Localization: Cytoplasm. Magnification: 60X.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, KO
TEF1 Antibody
NBP2-94035
Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEF1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 120s.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Paraffin-embedded mouse lung using TEF1.
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for SLC7A9 Antibody (NBP1-92409) (0)

There are no publications for SLC7A9 Antibody (NBP1-92409).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A9 Antibody (NBP1-92409) (0)

There are no reviews for SLC7A9 Antibody (NBP1-92409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC7A9 Antibody (NBP1-92409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SLC7A9 Products

Bioinformatics Tool for SLC7A9 Antibody (NBP1-92409)

Discover related pathways, diseases and genes to SLC7A9 Antibody (NBP1-92409). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A9 Antibody (NBP1-92409)

Discover more about diseases related to SLC7A9 Antibody (NBP1-92409).
 

Pathways for SLC7A9 Antibody (NBP1-92409)

View related products by pathway.

PTMs for SLC7A9 Antibody (NBP1-92409)

Learn more about PTMs related to SLC7A9 Antibody (NBP1-92409).

Blogs on SLC7A9.

Check out the latest blog posts on SLC7A9.
The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A9 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC7A9