Home » SLC7A9 » SLC7A9 Antibodies » SLC7A9 Antibody

SLC7A9 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: SLC7A9 Antibody [NBP1-92409] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunocytochemistry/ Immunofluorescence: SLC7A9 Antibody [NBP1-92409] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining in human kidney and lymph node tissues using anti-SLC7A9 antibody. Corresponding SLC7A9 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SLC7A9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE
Specificity
Specificity of human SLC7A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC7A9 Protein (NBP1-92409PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC7A9 Antibody

  • b(0,+)AT
  • b(0+)AT
  • B(0+)-type amino acid transporter 1
  • BAT1
  • bo+ amino acid transporter
  • CSNU3
  • FLJ94301
  • Glycoprotein-associated amino acid transporter b0+AT1
  • SLC7A9
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 9
  • Solute carrier family 7 member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SLC3A1 Antibody
NBP2-47272
Western Blot: SLC3A1 Antibody [NBP2-47272] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: SLC3A1 Antibody [NBP2-47272] - Staining of human cervix, uterine shows low expression as expected.
Immunohistochemistry: SLC3A1 Antibody [NBP2-47272] - Staining of human kidney shows strong cytoplasmic and membrane positivity in cells in tubules.
Species: Hu
Applications: WB, IHC, IHC-P
CD98 Antibody
NBP2-47515
Western Blot: CD98 Antibody [NBP2-47515] - Analysis in human cell lines SK-MEL-30 and HEK293 using anti-SLC3A2 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: CD98 Antibody [NBP2-47515] - Staining of human cell line U-2 OS shows localization to nucleus, plasma membrane and cytosol.
Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining in human parathyroid gland and skeletal muscle tissues using anti-SLC3A2 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA/CF
Recombinant Human TNF-alpha (Catalog # 210‑TA/CF) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(475 Publications)
Species: Hu
SLC7A5/LAT1
Antibody (BU53)
NBP2-50465
Flow (Cell Surface): SLC7A5/LAT1 Antibody (BU53) [NBP2-50465] - A cell surface stain was performed on Raji cells with SLC7A5 (BU53) antibody NBP2-50465AF647 (blue) along with a matched isotype control NB600-986AF647 (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at RT. Both antibodies were conjugated to Alexa Fluor 647.
Flow (Cell Surface): SLC7A5/LAT1 Antibody (BU53) [NBP2-50465] - A cell surface stain was performed on Raji cells with SLC7A5 (BU53) antibody NBP2-50465 (blue) along with a matched isotype control NB600-986 (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at RT, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
MHC Class I
Antibody (OX18)
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MHC Class I Antibody (OX18) [NB120-6405] - IHC analysis of formalin fixed paraffin-embedded (FFPE) rat brain cerebellum using MHC Class I (OK18) antibody at 1:200 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Endothelial staining was observed. Staining was performed by Histowiz.
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
(29 Publications)
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NFKBIL1 Antibody
NBP1-70344
Western Blot: NFKBIL1 Antibody [NBP1-70344] - analysis of NFKBIL1. Lanes 1 and 2 show HeLa cell lysate probed with pre-immune sera (1:5000) and NFKBIL1 polyclonal antibody (3 ug/ml), respectively.
Species: Hu, Am, Bv, Ca, Eq, Pm
Applications: WB
LAT Antibody
(LAT.10-17)
NBP2-00289
Western Blot: LAT Antibody (LAT.10-17) [NBP2-00289] - 10e6 normal peripheral human blood cells (lane 1), Jurkat (lane 2), and C57BL/6 splenocytes (lane 3) with 5 ug/mL Anti-Human LAT Purified. Bands were visualized using Anti-Mouse IgG HRP.
Immunohistochemistry-Paraffin: LAT Antibody (LAT.10-17) [NBP2-00289] - Staining of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 20 ug/ml.
Flow (Cell Surface): LAT Antibody (LAT.10-17) [NBP2-00289] - Analysis using the Allophycocyanin conjugate of NBP2-00289. Surface staining of normal human peripheral blood cells with Anti-Human CD3 FITC followed by intracellular staining with Mouse IgG1 kappa Isotype Control APC (left) or Anti-Human LAT APC (right).
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
SLC7A8 Antibody
(OTI7D6)
NBP1-47989
Western Blot: SLC7A8 Antibody (7D6) [NBP1-47989] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SLC7A8 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SLC7A8.
Immunohistochemistry-Paraffin: SLC7A8 Antibody (7D6) [NBP1-47989] - Carcinoma of bladder tissue.
Immunohistochemistry-Paraffin: SLC7A8 Antibody (7D6) [NBP1-47989] - Staining of paraffin-embedded Adenocarcinoma of breast tissue using anti-SLC7A8 mouse monoclonal antibody.
Species: Hu
Applications: WB, IHC, IHC-P
Lymphotoxin
[Unconjugated]
8884-LY
Lymphotoxin [Unconjugated]
(3 Publications)
Species: Hu
UAP56 Antibody
NBP2-58594
Western Blot: UAP56 Antibody [NBP2-58594] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: UAP56 Antibody [NBP2-58594] - Staining of human cell line MCF7 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: UAP56 Antibody [NBP2-58594] - Staining in human epididymis and duodenum tissues using anti-DDX39B antibody. Corresponding DDX39B RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CAT1 Antibody
NBP1-90066
Western Blot: CAT1 Antibody [NBP1-90066] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CAT1 Antibody [NBP1-90066] - Staining of human small intestine shows strong membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
BAT2 Antibody
35680002
ELISA: BAT2 Antibody [35680002]
(2 Publications)
Species: Hu
Applications: WB, ELISA
NTAL Antibody
(440005)
MAB4066
Western blot shows lysates of Raji human Burkitt's lymphoma cell line and THP‑1 human acute monocytic leukemia cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human NTAL Monoclonal Antibody (Catalog # MAB4066) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for NTAL at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
THP‑1 human acute monocytic leukemia cell line was stained with Mouse Anti-Human NTAL Monoclonal Antibody (Catalog # MAB4066, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
EAAT3 Antibody
NBP1-84938
Western Blot: EAAT3 Antibody [NBP1-84938] - Analysis in control (vector only transfected HEK293T lysate) and SLC1A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401342).
Immunohistochemistry-Paraffin: EAAT3 Antibody [NBP1-84938] - Staining of human small intestine shows strong luminal membranous positivity in glandular
Species: Hu
Applications: WB, IHC, IHC-P
SLC7A7 Antibody
NBP1-82826
Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining in human kidney and prostate tissues using anti-SLC7A7 antibody. Corresponding SLC7A7 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
HLA B7 Antibody
NBP2-29931
Western Blot: HLA B7 Antibody [NBP2-29931] - Analysis of lysates from HL-60, Jurkat, Ramos cell line (from left to right), using HLA-B Antibody (N-term). Diluted at 1:1000 at each lane. A goat anti-rabbit IgG H&L(HRP) at 1:5000 dilution was used as the secondary antibody. Lysates at 35ug per lane.
Immunohistochemistry-Paraffin: HLA B7 Antibody [NBP2-29931] - Formalin-fixed and paraffin-embedded human hepatocarcinoma reacted with HLA-B Antibody (N-term), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
Flow Cytometry: HLA B7 Antibody [NBP2-29931] - Analysis of human peripheral blood lymphocytes cells using HLA-B Antibody (N-term) (green, compared to an isotype control of rabbit IgG (blue). Diluted at 1:25 dilution. An Alexa Fluor 488-conjugated goat anti-rabbit lgG at 1:400 dilution was used as the secondary antibody.
Species: Hu
Applications: WB, Flow, IHC-P
LST1 Antibody
(LST1/02)
NBP1-45072
Western Blot: LST1 Antibody (LST1/02) [NBP1-45072] - Analysis (non-reducing conditions) of LST1 in whole cell lysate of U937 human Caucasian histiocytic lymphoma cell line. Lane 1: immunostaining with Isotype mouse IgG1 control (PPV-06) Lane 2-3: immunostaining with anti-human LST1 (LST1/02), two independent batches. Note: It migrates on SDS PAGE gels as approximately 25-28 kDa molecule.
Species: Hu, Mu
Applications: WB, ICC/IF, IP
xCT Antibody
NB300-318
Western Blot: xCT Antibody [NB300-318] - Total protein from Human HeLa cells treated with and without 0.1 mM Diethyl Maleate for 24 hours was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-xCT in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence. Note the increase in xCT expression with treatment.
Immunocytochemistry/Immunofluorescence: xCT Antibody [NB300-318] - xCT antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: xCT Antibody [NB300-318] - xCT staining in the absorptive epithelia of small intestinal villi detected using NB300-318.
(2 Reviews)
(39 Publications)
Species: Hu, Mu, Rt
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
GIT1 Antibody
(924640) [Unconjugate
MAB8508
GIT1 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Mouse Anti-Human GIT1 Monoclonal Antibody (Catalog # MAB8508) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HUVEC human umbilical vein endothelial cells, U2OS human osteosarcoma cell line, M1 mouse myeloid leukemia cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human GIT1 Monoclonal Antibody (Catalog # MAB8508) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for GIT1 at approximately 95 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SH‑SY5Y human neuroblastoma cell line was stained with Mouse Anti-Human GIT1 Monoclonal Antibody (Catalog # MAB8508, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005).
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, CyTOF-ready, ICFlow
TEF1 Antibody
(13112)
NBP2-43581
Western Blot: TEF1 Antibody (13112) [NBP2-43581] - Analysis of whole cell extracts and extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with TEF1 antibody [13112] at a dilution of 1:500.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody (13112) [NBP2-43581] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: TEF1 protein stained by TEF1 antibody [GT13112] diluted at 1:400. Red: Phalloidin, a F-actin marker, diluted at 1:200.
Immunoprecipitation: TEF1 Antibody (13112) [NBP2-43581] - Immunoprecipitation of TEF1 protein from HeLa nuclear extracts using 5 ug of TEF1 antibody [13112]. Western blot analysis was performed using TEF1 antibody [13112] EasyBlot anti-Mouse IgG was used as a secondary reagent.
Species: Hu
Applications: WB, ICC/IF, IP

Publications for SLC7A9 Antibody (NBP1-92409) (0)

There are no publications for SLC7A9 Antibody (NBP1-92409).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A9 Antibody (NBP1-92409) (0)

There are no reviews for SLC7A9 Antibody (NBP1-92409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC7A9 Antibody (NBP1-92409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC7A9 Products

Bioinformatics Tool for SLC7A9 Antibody (NBP1-92409)

Discover related pathways, diseases and genes to SLC7A9 Antibody (NBP1-92409). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A9 Antibody (NBP1-92409)

Discover more about diseases related to SLC7A9 Antibody (NBP1-92409).
 

Pathways for SLC7A9 Antibody (NBP1-92409)

View related products by pathway.

PTMs for SLC7A9 Antibody (NBP1-92409)

Learn more about PTMs related to SLC7A9 Antibody (NBP1-92409).

Blogs on SLC7A9.

Check out the latest blog posts on SLC7A9.
The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A9 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC7A9
Entrez