SLC7A6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC7A6 Antibody [NBP2-30868] - Immunofluorescent staining of human cell line HeLa shows localization to vesicles.
Immunohistochemistry-Paraffin: SLC7A6 Antibody [NBP2-30868] - Staining of human breast shows distinct positivity in myoepithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC7A6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC7A6 Protein (NBP2-30868PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC7A6 Antibody

  • Y+L amino acid transporter 2
  • LAT2
  • LAT-2
  • LAT3
  • SLC7A6
  • solute carrier family 7 (amino acid transporter light chain, y+L system), member 6
  • Y+LAT2
  • y+LAT-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
H00009056-B01P
Species: Hu, Rt
Applications: WB
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB8508
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-58924
Species: Hu
Applications: ICC/IF
MAB3694
Species: Hu
Applications: WB, IHC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC

Publications for SLC7A6 Antibody (NBP2-30868) (0)

There are no publications for SLC7A6 Antibody (NBP2-30868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A6 Antibody (NBP2-30868) (0)

There are no reviews for SLC7A6 Antibody (NBP2-30868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC7A6 Antibody (NBP2-30868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC7A6 Products

Bioinformatics Tool for SLC7A6 Antibody (NBP2-30868)

Discover related pathways, diseases and genes to SLC7A6 Antibody (NBP2-30868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A6 Antibody (NBP2-30868)

Discover more about diseases related to SLC7A6 Antibody (NBP2-30868).
 

Pathways for SLC7A6 Antibody (NBP2-30868)

View related products by pathway.

PTMs for SLC7A6 Antibody (NBP2-30868)

Learn more about PTMs related to SLC7A6 Antibody (NBP2-30868).

Blogs on SLC7A6

There are no specific blogs for SLC7A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A6
Entrez
Uniprot