SLC6A8 Antibody - Azide and BSA Free

Western Blot: SLC6A8 Antibody [NBP2-94178] - Analysis of extracts of various cell lines, using SLC6A8 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC6A8 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SLC6A8 Antibody - Azide and BSA Free (NBP2-94178) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 539-635 of human SLC6A8 (NP_005620.1). VVYYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC6A8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500-1:2000
• Theoretical MW: 71 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SLC6A8 Antibody - Azide and BSA Free

• CCDS1
• CHOT1
• Creat
• Creatine Transporter 1
• CRT
• CRTR
• CRTRcreatine transporter SLC6A8
• CT1
• CT1MGC87396
• SLC6A8
• sodium- and chloride-dependent creatine transporter 1
• solute carrier family 6 (neurotransmitter transporter, creatine), member 8
• Solute carrier family 6 member 8

Background

The protein encoded by the SLC6A8 gene is a plasma membrane protein whose function is to transport creatine into and out of cells. Defects in this gene can result in X-linked creatine deficiency syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC6A8