SLC48A1 Antibody - BSA Free

Western Blot: SLC48A1 Antibody [NBP1-91563] - Host: Rabbit. Target Name: SLC48A1. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 1ug/ml

Immunohistochemistry-Paraffin: SLC48A1 Antibody [NBP1-91563] - Human Placenta Decidual cells (indicated with arrows), 4-8ug/ml.

Western Blot: SLC48A1 Antibody [NBP1-91563] - HepG2 cell lysate, Antibody Titration: 0.0625ug/ml

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC48A1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human FLJ20489. Peptide sequence LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC48A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33115468).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC48A1 Antibody - BSA Free

• FLJ20489
• solute carrier family 48 (heme transporter), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC48A1 Antibody (NBP1-91563)(2)

Publications using NBP1-91563

• Yuan J, Liu T, Zhang Y. An Iron Metabolism-Related Gene Signature for the Prognosis of Colon Cancer Frontiers in Cell and Developmental Biology 2022-01-18 [PMID: 35118074] (Immunohistochemistry, Mouse)
• Tang B, Zhu J, Li J et al. The ferroptosis and iron-metabolism signature robustly predicts clinical diagnosis, prognosis and immune microenvironment for hepatocellular carcinoma Cell Commun Signal 2020-10-28 [PMID: 33115468] (IF/IHC, Mouse)

FAQs for SLC48A1 Antibody (NBP1-91563). (Showing 1 - 1 of 1 FAQs).

1. Does this work with mouse SLC48A1 ? Just to double check this heme-regulated gene 1, the heme transporter ?
   • Product NBP1-91563 has not yet been tested for detection of the mouse protein. We have only validated it for human samples. The immunogen used shares only 27% homology to the mouse sequence, so I do not think it would be a good choice for your experiment. The antibody is made to the Heme transporter HRG1 human protein http://www.uniprot.org/uniprot/Q6P1K1.

Bioinformatics

• Gene Symbol: SLC48A1
• Uniprot:
  • NP_060312(Human)