SLC39A10 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC39A10 Antibody [NBP1-85080] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC39A10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKETVEVSVKSDDKHMHDHNHRLRHHHRLHHHLDHNNTHHFHNDSITPSERGEPSNEPSTETNKTQEQSDVKLPKGKRKKKGRKSNENSEVITPGFP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC39A10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC39A10 Protein (NBP1-85080PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC39A10 Antibody

  • DKFZp564L2123
  • DKFZp781L10106
  • FLJ90515
  • KIAA1265
  • LZT-Hs2
  • MGC126565
  • MGC138428
  • solute carrier family 39 (metal ion transporter), member 10
  • solute carrier family 39 (zinc transporter), member 10
  • Solute carrier family 39 member 10
  • zinc transporter ZIP10
  • ZIP10
  • ZIP-10
  • Zrt- and Irt-like protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NBP2-55609
Species: Hu
Applications: WB, ICC/IF
NBP1-76505
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-76510
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB2380
Species: Hu
Applications: WB
NBP1-59357
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69296
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF7315
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
AF7318
Species: Hu
Applications: IHC
NBP1-85007
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82299
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-84164
Species: Hu
Applications: IHC, IHC-P
NBP1-85080
Species: Hu
Applications: IHC, IHC-P

Publications for SLC39A10 Antibody (NBP1-85080) (0)

There are no publications for SLC39A10 Antibody (NBP1-85080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC39A10 Antibody (NBP1-85080) (0)

There are no reviews for SLC39A10 Antibody (NBP1-85080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC39A10 Antibody (NBP1-85080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC39A10 Products

Bioinformatics Tool for SLC39A10 Antibody (NBP1-85080)

Discover related pathways, diseases and genes to SLC39A10 Antibody (NBP1-85080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC39A10 Antibody (NBP1-85080)

Discover more about diseases related to SLC39A10 Antibody (NBP1-85080).
 

Pathways for SLC39A10 Antibody (NBP1-85080)

View related products by pathway.

PTMs for SLC39A10 Antibody (NBP1-85080)

Learn more about PTMs related to SLC39A10 Antibody (NBP1-85080).

Blogs on SLC39A10

There are no specific blogs for SLC39A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC39A10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC39A10