SLC38A2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SLC38A2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC38A2
  
  

  Source: E.coli

  Amino Acid Sequence: PCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SLC38A2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25144It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC38A2 Recombinant Protein Antigen

• Amino acid transporter A2
• ata2
• ATA2System A transporter 1
• KIAA1382System N amino acid transporter 2
• pro1068
• Protein 40-9-1
• sat2
• SAT2PRO1068
• snat2
• SNAT2amino acid transporter 2
• sodium-coupled neutral amino acid transporter 2
• Solute carrier family 38 member 2
• solute carrier family 38, member 2
• System A amino acid transporter 2

Background

SLC38A2 functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC38A2