SLC38A1 Antibody - BSA Free

Staining of human lymph node shows moderate membranous positivity in germinal center cells.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in subset of neuronal cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human cerebellum shows moderate cytoplasmic positivity in subset of cells in granular layer.

• Reactivity: Hu, Rt, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC38A1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC38A1 Antibody - BSA Free (NBP2-13336) is a polyclonal antibody validated for use in IHC. Anti-SLC38A1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT
• Predicted Species: Mouse (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC38A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC38A1 Protein (NBP2-13336PEP)

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 30240589).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC38A1 Antibody - BSA Free

• Amino acid transporter A1
• ATA1SNAT1
• NAT2N-system amino acid transporter 2
• SAT1amino acid transporter system A1
• sodium-coupled neutral amino acid transporter 1
• Solute carrier family 38 member 1
• solute carrier family 38, member 1
• System A amino acid transporter 1
• System N amino acid transporter 1

Background

Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism,detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in thedetoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter,glutamate (Gu et al., 2001 (PubMed 11325958)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC38A1 Antibody (NBP2-13336)(2)

Publications using NBP2-13336

• Mariana Borsa, Sandrine Obba, Felix C. Richter, Hanlin Zhang, Thomas Riffelmacher, Joana Carrelha, Ghada Alsaleh, Sten Eirik W. Jacobsen, Anna Katharina Simon Autophagy preserves hematopoietic stem cells by restraining MTORC1-mediated cellular anabolism Autophagy 2023-08-23 [PMID: 37614038]
• Shimamoto A, Rappeneau V, Munjal H et al. Glutamate-Glutamine Transfer and Chronic Stress-Induced Sex Differences in Cocaine Responses. Neuroscience 2018-09-19 [PMID: 30240589] (IF/IHC, Rat)

Bioinformatics

• Gene Symbol: SLC38A1