SLC38A1 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC38A1 Antibody [NBP2-13336] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC38A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLT NSHLEKKKCDEYIPGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC38A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC38A1 Protein (NBP2-13336PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC38A1 Antibody

  • Amino acid transporter A1
  • ATA1SNAT1
  • NAT2N-system amino acid transporter 2
  • SAT1amino acid transporter system A1
  • sodium-coupled neutral amino acid transporter 1
  • Solute carrier family 38 member 1
  • solute carrier family 38, member 1
  • System A amino acid transporter 1
  • System N amino acid transporter 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-60103
Species: Hu
Applications: WB, IHC
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81010
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-13336
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for SLC38A1 Antibody (NBP2-13336) (0)

There are no publications for SLC38A1 Antibody (NBP2-13336).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC38A1 Antibody (NBP2-13336) (0)

There are no reviews for SLC38A1 Antibody (NBP2-13336). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC38A1 Antibody (NBP2-13336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC38A1 Products

Bioinformatics Tool for SLC38A1 Antibody (NBP2-13336)

Discover related pathways, diseases and genes to SLC38A1 Antibody (NBP2-13336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC38A1 Antibody (NBP2-13336)

Discover more about diseases related to SLC38A1 Antibody (NBP2-13336).
 

Pathways for SLC38A1 Antibody (NBP2-13336)

View related products by pathway.

PTMs for SLC38A1 Antibody (NBP2-13336)

Learn more about PTMs related to SLC38A1 Antibody (NBP2-13336).

Blogs on SLC38A1

There are no specific blogs for SLC38A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC38A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC38A1