SLC2A4RG Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody [NBP2-57221] - Staining of human cell line MCF7 shows localization to nuclear speckles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC2A4RG Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC2A4RG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC2A4RG Recombinant Protein Antigen (NBP2-57221PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC2A4RG Antibody - BSA Free

• GEFHDBP-1
• HDBP1GLUT4 enhancer factor
• Huntington disease gene regulatory region-binding protein 1
• Huntington's disease gene regulatory region-binding protein 1
• Si-1-2
• Si-1-2-19
• SLC2A4 regulator

Background

SLC2A4RG is encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC2A4RG