SLC2A4RG Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC2A4RG Antibody [NBP2-57221] - Staining of human cell line MCF7 shows localization to nuclear speckles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC2A4RG Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKP
Specificity
Specificity of human SLC2A4RG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A4RG
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLC2A4RG Antibody

  • GEFHDBP-1
  • HDBP1GLUT4 enhancer factor
  • Huntington disease gene regulatory region-binding protein 1
  • Huntington's disease gene regulatory region-binding protein 1
  • Si-1-2
  • Si-1-2-19
  • SLC2A4 regulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PEP-ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80917
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67165
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-75641
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-57221
Species: Hu
Applications: ICC/IF

Publications for SLC2A4RG Antibody (NBP2-57221) (0)

There are no publications for SLC2A4RG Antibody (NBP2-57221).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC2A4RG Antibody (NBP2-57221) (0)

There are no reviews for SLC2A4RG Antibody (NBP2-57221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC2A4RG Antibody (NBP2-57221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC2A4RG Products

Bioinformatics Tool for SLC2A4RG Antibody (NBP2-57221)

Discover related pathways, diseases and genes to SLC2A4RG Antibody (NBP2-57221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC2A4RG Antibody (NBP2-57221)

Discover more about diseases related to SLC2A4RG Antibody (NBP2-57221).
 

Pathways for SLC2A4RG Antibody (NBP2-57221)

View related products by pathway.

PTMs for SLC2A4RG Antibody (NBP2-57221)

Learn more about PTMs related to SLC2A4RG Antibody (NBP2-57221).

Blogs on SLC2A4RG

There are no specific blogs for SLC2A4RG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC2A4RG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A4RG