SLC29A3 Antibody

Images

 
Western Blot: SLC29A3 Antibody [NBP2-31589] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: SLC29A3 Antibody [NBP2-31589] - Staining of human ovary shows strong cytoplasmic positivity in follicle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC29A3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRPILKKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC29A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC29A3 Protein (NBP2-31589PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC29A3 Antibody

  • equilibrative nucleoside transporter 3
  • ENT3
  • HCLAP
  • HJCD
  • PHID
  • solute carrier family 29 (nucleoside transporters), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-50508
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-69312
Species: Hu
Applications: WB, IHC, IHC-P
H00009685-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33451
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30857
Species: Hu
Applications: IHC, IHC-P
NBP1-84418
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41314
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IF
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NB600-920
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
366-6C/CF
Species: Hu
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA

Publications for SLC29A3 Antibody (NBP2-31589) (0)

There are no publications for SLC29A3 Antibody (NBP2-31589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC29A3 Antibody (NBP2-31589) (0)

There are no reviews for SLC29A3 Antibody (NBP2-31589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC29A3 Antibody (NBP2-31589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC29A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC29A3
Uniprot