SLC29A3 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC29A3 Antibody [NBP2-31589] -Staining of human urinary bladder shows strong membranous and cytoplasmic positivity in urothelial cells.

Western Blot: SLC29A3 Antibody [NBP2-31589] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)

Immunohistochemistry-Paraffin: SLC29A3 Antibody [NBP2-31589] -Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: SLC29A3 Antibody [NBP2-31589] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: SLC29A3 Antibody [NBP2-31589] -Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC29A3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC29A3 Antibody - BSA Free (NBP2-31589) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRPILKKT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC29A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC29A3 Protein (NBP2-31589PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC29A3 Antibody - BSA Free

• equilibrative nucleoside transporter 3
• ENT3
• HCLAP
• hENT3
• HJCD
• PHID
• SLC29A3
• solute carrier family 29 (nucleoside transporters), member 3
• UNQ717/PRO1380

Background

Nucleoside transporters, such as SLC29A3, mediate uptake of precursors for nucleotide synthesis by salvage pathways. They are also required for uptake of hydrophilic anticancer and antiviral nucleoside drugs (Baldwin et al., 2005 (PubMed 15701636)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC29A3
• Uniprot:
  • Q9BZD2(Human)