SLC26A8 Antibody

Images

 
Western Blot: SLC26A8 Antibody [NBP1-87419] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG Lane 4: Human Plasma Lane 5: Human liver ...read more
Immunohistochemistry: SLC26A8 Antibody [NBP1-87419] - Staining of human testis shows strong cytoplasmic and moderate nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC26A8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELEPEMEPKAETETKTQTEMEPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSVERRRHPMDSYSPEGNSNEDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC26A8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC26A8 Protein (NBP1-87419PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC26A8 Antibody

  • solute carrier family 26, member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41079
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-60965
Species: Hu, Mu
Applications: WB, ICC/IF
H00029127-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow

Publications for SLC26A8 Antibody (NBP1-87419) (0)

There are no publications for SLC26A8 Antibody (NBP1-87419).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC26A8 Antibody (NBP1-87419) (0)

There are no reviews for SLC26A8 Antibody (NBP1-87419). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC26A8 Antibody (NBP1-87419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC26A8 Products

Bioinformatics Tool for SLC26A8 Antibody (NBP1-87419)

Discover related pathways, diseases and genes to SLC26A8 Antibody (NBP1-87419). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A8 Antibody (NBP1-87419)

Discover more about diseases related to SLC26A8 Antibody (NBP1-87419).
 

Pathways for SLC26A8 Antibody (NBP1-87419)

View related products by pathway.

PTMs for SLC26A8 Antibody (NBP1-87419)

Learn more about PTMs related to SLC26A8 Antibody (NBP1-87419).

Blogs on SLC26A8

There are no specific blogs for SLC26A8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC26A8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC26A8