SLC26A8 Antibody


Western Blot: SLC26A8 Antibody [NBP1-70717] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
Immunohistochemistry-Paraffin: SLC26A8 Antibody [NBP1-70717] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SLC26A8 Antibody Summary

Synthetic peptides corresponding to SLC26A8(solute carrier family 26, member 8) The peptide sequence was selected from the C terminal of SLC26A8. Peptide sequence EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC26A8 Antibody

  • solute carrier family 26, member 8


SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, CyTOF-ready, ICFlow

Publications for SLC26A8 Antibody (NBP1-70717) (0)

There are no publications for SLC26A8 Antibody (NBP1-70717).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC26A8 Antibody (NBP1-70717) (0)

There are no reviews for SLC26A8 Antibody (NBP1-70717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC26A8 Antibody (NBP1-70717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC26A8 Products

SLC26A8 NBP1-70717

Bioinformatics Tool for SLC26A8 Antibody (NBP1-70717)

Discover related pathways, diseases and genes to SLC26A8 Antibody (NBP1-70717). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A8 Antibody (NBP1-70717)

Discover more about diseases related to SLC26A8 Antibody (NBP1-70717).

Pathways for SLC26A8 Antibody (NBP1-70717)

View related products by pathway.

PTMs for SLC26A8 Antibody (NBP1-70717)

Learn more about PTMs related to SLC26A8 Antibody (NBP1-70717).

Blogs on SLC26A8

There are no specific blogs for SLC26A8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC26A8 Antibody and receive a gift card or discount.


Gene Symbol SLC26A8