SLC26A8 Antibody

Images

 
Western Blot: SLC26A8 Antibody [NBP1-70717] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
Immunohistochemistry-Paraffin: SLC26A8 Antibody [NBP1-70717] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC26A8 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC26A8(solute carrier family 26, member 8) The peptide sequence was selected from the C terminal of SLC26A8. Peptide sequence EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC26A8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC26A8 Antibody

  • solute carrier family 26, member 8

Background

SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41079
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-60965
Species: Hu, Mu
Applications: WB, ICC/IF
H00029127-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow

Publications for SLC26A8 Antibody (NBP1-70717) (0)

There are no publications for SLC26A8 Antibody (NBP1-70717).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC26A8 Antibody (NBP1-70717) (0)

There are no reviews for SLC26A8 Antibody (NBP1-70717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC26A8 Antibody (NBP1-70717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC26A8 Products

Bioinformatics Tool for SLC26A8 Antibody (NBP1-70717)

Discover related pathways, diseases and genes to SLC26A8 Antibody (NBP1-70717). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A8 Antibody (NBP1-70717)

Discover more about diseases related to SLC26A8 Antibody (NBP1-70717).
 

Pathways for SLC26A8 Antibody (NBP1-70717)

View related products by pathway.

PTMs for SLC26A8 Antibody (NBP1-70717)

Learn more about PTMs related to SLC26A8 Antibody (NBP1-70717).

Blogs on SLC26A8

There are no specific blogs for SLC26A8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC26A8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC26A8