| Reactivity | Hu, PoSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 2E3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC26A3 (NP_000102, 503 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT |
| Specificity | SLC26A3 - solute carrier family 26, member 3 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC26A3 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00001811-M01 | Applications | Species |
|---|---|---|
| Abdulnour-Nakhoul S, Nakhoul HN, Kalliny MI et al. ION TRANSPORT MECHANISMS LINKED TO BICARBONATE SECRETION IN THE ESOPHAGEAL SUBMUCOSAL GLANDS. Am J Physiol Regul Integr Comp Physiol 2011-04-06 [PMID: 21474426] |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC26A3 Antibody (H00001811-M01)Find related products by research area.
|
|
Next-Gen DNA Sequencing and SLC26A3 Research The SLC26A3, also known as DRA (downregulated-in-adenoma) gene is a member of the sulphate anion transporter family, serving an important role in the exchange and transport of chloride, bicarbonate and sulphate ions at plasma membrane sites. We at Nov... Read full blog post. |
|
Antibody Therapies and the New Generation of DNA Sequencing Our antibody database is primarily focused on protein-coding genes. Although they form only 1% of the total human genome, these important genes account for 85% of the mutations that lead to disease.DNA sequencing (defining the sequence of the 4 base... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.