SLC26A3 Antibody (2E3.)

Images

 
Immunohistochemistry-Paraffin: SLC26A3 Antibody (2E3) [H00001811-M01] - Analysis of monoclonal antibody to SLC26A3 on formalin-fixed paraffin-embedded human spleen. Antibody concentration 1.8 ug/ml.
Sandwich ELISA: SLC26A3 Antibody (2E3) [H00001811-M01] - Detection limit for recombinant GST tagged SLC26A3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2E3.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC26A3 Antibody (2E3.) Summary

Immunogen
SLC26A3 (NP_000102 503 a.a. - 600 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT
Specificity
SLC26A3 - solute carrier family 26, member 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC26A3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001811-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC26A3 Antibody (2E3.)

  • chloride anion exchanger
  • CLD
  • congenital chloride diarrhea
  • down-regulated in adenoma protein
  • DRADown-regulated in adenoma
  • Protein DRA
  • Solute carrier family 26 member 3
  • solute carrier family 26, member 3

Background

The protein encoded by this gene is a transmembrane glycoprotein that functions as a sulfate transporter. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. Mutations in this gene have been associated with congenital chloride diarrhea.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-47273
Species: Hu
Applications: IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-77855
Species: Hu, Bb, Ca, Pm
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-CS
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-59791
Species: Hu
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBL1-12547
Species: Hu
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC26A3 Antibody (H00001811-M01)(1)

Reviews for SLC26A3 Antibody (H00001811-M01) (0)

There are no reviews for SLC26A3 Antibody (H00001811-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC26A3 Antibody (H00001811-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC26A3 Products

Bioinformatics Tool for SLC26A3 Antibody (H00001811-M01)

Discover related pathways, diseases and genes to SLC26A3 Antibody (H00001811-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A3 Antibody (H00001811-M01)

Discover more about diseases related to SLC26A3 Antibody (H00001811-M01).
 

Pathways for SLC26A3 Antibody (H00001811-M01)

View related products by pathway.

PTMs for SLC26A3 Antibody (H00001811-M01)

Learn more about PTMs related to SLC26A3 Antibody (H00001811-M01).

Blogs on SLC26A3.

Next-Gen DNA Sequencing and SLC26A3 Research
The SLC26A3, also known as DRA (downregulated-in-adenoma) gene is a member of the sulphate anion transporter family, serving an important role in the exchange and transport of chloride, bicarbonate and sulphate ions at plasma membrane sites. We at Nov...  Read full blog post.

Antibody Therapies and the New Generation of DNA Sequencing
Our antibody database is primarily focused on protein-coding genes. Although they form only 1% of the total human genome, these important genes account for 85% of the mutations that lead to disease.DNA sequencing (defining the sequence of the 4 base...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC26A3 Antibody (2E3.) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC26A3
Entrez
OMIM
Uniprot