SLC25A46 Antibody

Images

 
Western Blot: SLC25A46 Antibody [NBP2-57347] - Western blot analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: SLC25A46 Antibody [NBP2-57347] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A46 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPI
Specificity
Specificity of human SLC25A46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A46
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
SLC25A46 Knockout 293T Cell Lysate
Control Peptide
SLC25A46 Recombinant Protein Antigen (NBP2-57347PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLC25A46 Antibody

  • solute carrier family 25 member 46
  • solute carrier family 25, member 46
  • TB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NB100-56152
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-545
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56536
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS, Flow-IC
7559-ST
Species: Hu
H00006690-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP1-84307
Species: Hu
Applications: WB, ICC/IF
NBP2-73857
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
NBP2-92892
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57347
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SLC25A46 Antibody (NBP2-57347) (0)

There are no publications for SLC25A46 Antibody (NBP2-57347).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A46 Antibody (NBP2-57347) (0)

There are no reviews for SLC25A46 Antibody (NBP2-57347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A46 Antibody (NBP2-57347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC25A46 Products

Bioinformatics Tool for SLC25A46 Antibody (NBP2-57347)

Discover related pathways, diseases and genes to SLC25A46 Antibody (NBP2-57347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A46 Antibody (NBP2-57347)

Discover more about diseases related to SLC25A46 Antibody (NBP2-57347).
 

Pathways for SLC25A46 Antibody (NBP2-57347)

View related products by pathway.

Blogs on SLC25A46

There are no specific blogs for SLC25A46, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A46 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A46