Recombinant Human SLC25A33 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC25A33 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-321 of Human SLC25A33 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ

Protein/Peptide Type
Recombinant Protein
Gene
SLC25A33

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC25A33 Protein

  • BMSC-MCPPNC1 protein
  • Bone marrow stromal cell mitochondrial carrier protein
  • HuBMSC-MCP
  • MGC4399
  • mitochondrial carrier protein
  • novel mitochondrial carrier protein
  • Protein PNC1
  • solute carrier family 25 member 33
  • solute carrier family 25, member 33

Background

SLC25A33 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-31820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84617
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB120-5663
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-55994
Species: Hu
Applications: ICC/IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-76998
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
H00084275-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SLC25A33 Recombinant Protein (H00084275-P01) (0)

There are no publications for SLC25A33 Recombinant Protein (H00084275-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A33 Recombinant Protein (H00084275-P01) (0)

There are no reviews for SLC25A33 Recombinant Protein (H00084275-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A33 Recombinant Protein (H00084275-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC25A33 Products

Bioinformatics Tool for SLC25A33 Recombinant Protein (H00084275-P01)

Discover related pathways, diseases and genes to SLC25A33 Recombinant Protein (H00084275-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A33 Recombinant Protein (H00084275-P01)

Discover more about diseases related to SLC25A33 Recombinant Protein (H00084275-P01).
 

Pathways for SLC25A33 Recombinant Protein (H00084275-P01)

View related products by pathway.

PTMs for SLC25A33 Recombinant Protein (H00084275-P01)

Learn more about PTMs related to SLC25A33 Recombinant Protein (H00084275-P01).

Blogs on SLC25A33

There are no specific blogs for SLC25A33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BID Antibody
NB100-56106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC25A33 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A33