SLC25A29 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC25A29 Antibody [NBP1-88425] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A29 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HDSPLNQFLAGAAAGAIQCVICCPMELAKTRLQLQDAGPARTYKGSLDCLAQIYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALGCEPGDRLLVPKLLLAGGTSGIVSWLSTYPVDVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A29
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC25A29 Protein (NBP1-88425PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A29 Antibody

  • C14orf69
  • CACL
  • CACT-like
  • carnitine-acylcarnitine translocase like
  • chromosome 14 open reading frame 69
  • FLJ38975
  • mitochondrial carnitine/acylcarnitine carrier protein CACL
  • Solute carrier family 25 member 29
  • solute carrier family 25, member 29

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-86690
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-42805
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-84380
Species: Hu
Applications: IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF842
Species: Hu
Applications: WB
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC25A29 Antibody (NBP1-88425) (0)

There are no publications for SLC25A29 Antibody (NBP1-88425).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A29 Antibody (NBP1-88425) (0)

There are no reviews for SLC25A29 Antibody (NBP1-88425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC25A29 Antibody (NBP1-88425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A29 Products

Bioinformatics Tool for SLC25A29 Antibody (NBP1-88425)

Discover related pathways, diseases and genes to SLC25A29 Antibody (NBP1-88425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A29 Antibody (NBP1-88425)

Discover more about diseases related to SLC25A29 Antibody (NBP1-88425).
 

Pathways for SLC25A29 Antibody (NBP1-88425)

View related products by pathway.

PTMs for SLC25A29 Antibody (NBP1-88425)

Learn more about PTMs related to SLC25A29 Antibody (NBP1-88425).

Blogs on SLC25A29

There are no specific blogs for SLC25A29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A29 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A29