Recombinant Human SLC25A21 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLC25A21 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 36-99 of Human SLC25A21

Source: Wheat Germ

Amino Acid Sequence: VVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC25A21
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
32.78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC25A21 Protein

  • MGC126570
  • ODC1
  • ODCmitochondrial 2-oxodicarboxylate carrier
  • oxodicarboxylate carrier
  • solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21
  • Solute carrier family 25 member 21

Background

SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-87094
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15447
Species: Hu
Applications: WB
NBP2-15447
Species: Hu
Applications: WB
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-82497
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00089874-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SLC25A21 Partial Recombinant Protein (H00089874-Q01) (0)

There are no publications for SLC25A21 Partial Recombinant Protein (H00089874-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A21 Partial Recombinant Protein (H00089874-Q01) (0)

There are no reviews for SLC25A21 Partial Recombinant Protein (H00089874-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A21 Partial Recombinant Protein (H00089874-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SLC25A21 Partial Recombinant Protein (H00089874-Q01)

Discover related pathways, diseases and genes to SLC25A21 Partial Recombinant Protein (H00089874-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A21 Partial Recombinant Protein (H00089874-Q01)

Discover more about diseases related to SLC25A21 Partial Recombinant Protein (H00089874-Q01).
 

Pathways for SLC25A21 Partial Recombinant Protein (H00089874-Q01)

View related products by pathway.

PTMs for SLC25A21 Partial Recombinant Protein (H00089874-Q01)

Learn more about PTMs related to SLC25A21 Partial Recombinant Protein (H00089874-Q01).

Blogs on SLC25A21

There are no specific blogs for SLC25A21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC25A21 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A21