Antizyme inhibitor 1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Antizyme inhibitor 1 Antibody - BSA Free (NBP1-82497) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV |
| Predicted Species |
Mouse (97%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AZIN1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Antizyme inhibitor 1 Antibody - BSA Free
Background
Antizyme inhibitor 1, or AZIN1 for short, consists of a 448 amino acid isoform that is 49 kDa, and is involved in the stabilization of ornithine decarboxylase antizymes, which help to regulate polyamine biosynthesis and homeostasis. Disease research is currently being conducted with AZIN1 and a variety of diseases and disorders to determine the relationship between the two. These diseases include Fanconi's anemia, malaria, liver cirrhosis, prostatitis, Hepatitis C, Hepatitis B, fibrosis, anemia, and prostate cancer. This protein interacts with OAZ2, FANCA, FANCC, OAZ1, and OAZ3 in processes linked to metabolism and regulation of catalytic activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Publications for Antizyme inhibitor 1 Antibody (NBP1-82497) (0)
There are no publications for Antizyme inhibitor 1 Antibody (NBP1-82497).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Antizyme inhibitor 1 Antibody (NBP1-82497) (0)
There are no reviews for Antizyme inhibitor 1 Antibody (NBP1-82497).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Antizyme inhibitor 1 Antibody (NBP1-82497) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Antizyme inhibitor 1 Products
Research Areas for Antizyme inhibitor 1 Antibody (NBP1-82497)
Find related products by research area.
|
Blogs on Antizyme inhibitor 1