SLC23A2 Antibody - BSA Free

Western Blot: SLC23A2 Antibody [NBP1-59384] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC23A2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC23A2(solute carrier family 23 (nucleobase transporters), member 2) The peptide sequence was selected from the middle region of SLC23A2. Peptide sequence VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC23A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC23A2 Antibody - BSA Free

• KIAA0238SLC23A1
• Na(+)/L-ascorbic acid transporter 2
• Nucleobase transporter-like 1 protein
• Sodium-dependent vitamin C transporter 2
• sodium-dependent vitamin C transporter-2
• solute carrier family 23 (nucleobase transporters), member 1
• solute carrier family 23 (nucleobase transporters), member 2
• solute carrier family 23 member 2
• SVCT2NBTL1
• Yolk sac permease-like molecule 2
• YSPL2hSVCT2

Background

The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC23A2
• Uniprot:
  • Q9UGH3(Human)