SLC22A16 Antibody


Western Blot: SLC22A16 Antibody [NBP1-60040] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: SLC22A16 Antibody [NBP1-60040] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SLC22A16 Antibody Summary

Synthetic peptides corresponding to SLC22A16(solute carrier family 22 (organic cation transporter), member 16) The peptide sequence was selected from the N terminal of SLC22A16. Peptide sequence CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQW
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC22A16 and was validated on Western Blot and immunohistochemistry-paraffin


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC22A16 Antibody

  • Carnitine transporter 2
  • CT2Organic cation/carnitine transporter 6
  • Flipt 2
  • FLIPT2member 16
  • fly-like putative organic ion transporter 2
  • Fly-like putative transporter 2
  • organic cation transporter 6
  • Organic cation transporter OKB1
  • solute carrier family 22 (organic cation/carnitine transporter), member 16
  • solute carrier family 22 member 16


Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
Species: Hu
Applications: WB, ICC
Species: Rt
Applications: WB, ICC/IF, IHC, ICC
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow
Species: Hu, Ca, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC22A16 Antibody (NBP1-60040) (0)

There are no publications for SLC22A16 Antibody (NBP1-60040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A16 Antibody (NBP1-60040) (0)

There are no reviews for SLC22A16 Antibody (NBP1-60040). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A16 Antibody (NBP1-60040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC22A16 Antibody Products

Related Products by Gene

Bioinformatics Tool for SLC22A16 Antibody (NBP1-60040)

Discover related pathways, diseases and genes to SLC22A16 Antibody (NBP1-60040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A16 Antibody (NBP1-60040)

Discover more about diseases related to SLC22A16 Antibody (NBP1-60040).

Pathways for SLC22A16 Antibody (NBP1-60040)

View related products by pathway.

PTMs for SLC22A16 Antibody (NBP1-60040)

Learn more about PTMs related to SLC22A16 Antibody (NBP1-60040).

Blogs on SLC22A16

There are no specific blogs for SLC22A16, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our SLC22A16 Antibody and receive a gift card or discount.


Gene Symbol SLC22A16

Customers Who Bought This Also Bought