SLC22A16 Antibody


Western Blot: SLC22A16 Antibody [NBP1-60040] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: SLC22A16 Antibody [NBP1-60040] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SLC22A16 Antibody Summary

Synthetic peptides corresponding to SLC22A16(solute carrier family 22 (organic cation transporter), member 16) The peptide sequence was selected from the N terminal of SLC22A16. Peptide sequence CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQW
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC22A16 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC22A16 Antibody

  • Carnitine transporter 2
  • CT2Organic cation/carnitine transporter 6
  • Flipt 2
  • FLIPT2member 16
  • fly-like putative organic ion transporter 2
  • Fly-like putative transporter 2
  • organic cation transporter 6
  • Organic cation transporter OKB1
  • solute carrier family 22 (organic cation/carnitine transporter), member 16
  • solute carrier family 22 member 16


Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC22A16 Antibody (NBP1-60040) (0)

There are no publications for SLC22A16 Antibody (NBP1-60040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A16 Antibody (NBP1-60040) (0)

There are no reviews for SLC22A16 Antibody (NBP1-60040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A16 Antibody (NBP1-60040). (Showing 1 - 1 of 1 FAQ).

  1. I was looking for an SLC22A16 antibody that would work on dog/cat/mouse in WB & IHC -- do you know if yours does please? 
    • the 3 antibodies we have for the SLC22A16 were raised against the human protein sequence peptides. I did a blast homology of each peptide against each dog/cat and mouse and none of the sequences have good enough homology to use in dog/ cat or mouse.So we do not have a product that will work for your needs.We do have a custom antibody service through our sister company

Secondary Antibodies


Isotype Controls

Additional SLC22A16 Products

Bioinformatics Tool for SLC22A16 Antibody (NBP1-60040)

Discover related pathways, diseases and genes to SLC22A16 Antibody (NBP1-60040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A16 Antibody (NBP1-60040)

Discover more about diseases related to SLC22A16 Antibody (NBP1-60040).

Pathways for SLC22A16 Antibody (NBP1-60040)

View related products by pathway.

PTMs for SLC22A16 Antibody (NBP1-60040)

Learn more about PTMs related to SLC22A16 Antibody (NBP1-60040).

Blogs on SLC22A16

There are no specific blogs for SLC22A16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC22A16 Antibody and receive a gift card or discount.


Gene Symbol SLC22A16