SLC22A16 Antibody

Images

 
Western Blot: SLC22A16 Antibody [NBP1-60040] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: SLC22A16 Antibody [NBP1-60040] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A16 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC22A16(solute carrier family 22 (organic cation transporter), member 16) The peptide sequence was selected from the N terminal of SLC22A16. Peptide sequence CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQW
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A16
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC22A16 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC22A16 Antibody

  • Carnitine transporter 2
  • CT2Organic cation/carnitine transporter 6
  • Flipt 2
  • FLIPT2member 16
  • fly-like putative organic ion transporter 2
  • Fly-like putative transporter 2
  • organic cation transporter 6
  • Organic cation transporter OKB1
  • solute carrier family 22 (organic cation/carnitine transporter), member 16
  • solute carrier family 22 member 16

Background

Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57222
Species: Hu
Applications: ICC/IF
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF
NBP2-58020
Species: Hu
Applications: ICC/IF
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
MAB2864
Species: Hu, Rt
Applications: IHC, ICC
NBP2-42202
Species: Rt
Applications: WB, ICC/IF, IHC, ICC
NBP2-24658
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB, IHC-P
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP1-88736
Species: Hu
Applications: IHC, IHC-P
NBP1-83976
Species: Hu
Applications: IHC, IHC-P
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-69538
Species: Hu
Applications: WB
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-49872
Species: Mu, Rt
Applications: WB, PEP-ELISA

Publications for SLC22A16 Antibody (NBP1-60040) (0)

There are no publications for SLC22A16 Antibody (NBP1-60040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A16 Antibody (NBP1-60040) (0)

There are no reviews for SLC22A16 Antibody (NBP1-60040). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A16 Antibody (NBP1-60040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A16 Antibody Products

Related Products by Gene

Bioinformatics Tool for SLC22A16 Antibody (NBP1-60040)

Discover related pathways, diseases and genes to SLC22A16 Antibody (NBP1-60040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A16 Antibody (NBP1-60040)

Discover more about diseases related to SLC22A16 Antibody (NBP1-60040).
 

Pathways for SLC22A16 Antibody (NBP1-60040)

View related products by pathway.

PTMs for SLC22A16 Antibody (NBP1-60040)

Learn more about PTMs related to SLC22A16 Antibody (NBP1-60040).

Blogs on SLC22A16

There are no specific blogs for SLC22A16, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A16
Uniprot

Customers Who Bought This Also Bought