SLC22A16 Antibody - BSA Free

Western Blot: SLC22A16 Antibody [NBP1-60040] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml

Immunohistochemistry-Paraffin: SLC22A16 Antibody [NBP1-60040] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

SLC22A16 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC22A16(solute carrier family 22 (organic cation transporter), member 16) The peptide sequence was selected from the N terminal of SLC22A16. Peptide sequence CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A16
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for SLC22A16 Antibody - BSA Free

• Carnitine transporter 2
• CT2Organic cation/carnitine transporter 6
• Flipt 2
• FLIPT2member 16
• fly-like putative organic ion transporter 2
• Fly-like putative transporter 2
• organic cation transporter 6
• Organic cation transporter OKB1
• solute carrier family 22 (organic cation/carnitine transporter), member 16
• solute carrier family 22 member 16

Background

Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for SLC22A16 Antibody (NBP1-60040). (Showing 1 - 1 of 1 FAQ).

1. I was looking for an SLC22A16 antibody that would work on dog/cat/mouse in WB & IHC -- do you know if yours does please? 
   • the 3 antibodies we have for the SLC22A16 were raised against the human protein sequence peptides. I did a blast homology of each peptide against each dog/cat and mouse and none of the sequences have good enough homology to use in dog/ cat or mouse.So we do not have a product that will work for your needs.We do have a custom antibody service through our sister companyhttps://www.rndsystems.com/services/antibody-production-custom-development-services

Bioinformatics

• Gene Symbol: SLC22A16
• Uniprot:
  • Q96RU0(Human)