SLC22A13 Antibody - BSA Free Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
Synthetic peptides corresponding to SLC22A13(solute carrier family 22, member 13) The peptide sequence was selected from the N terminal of SLC22A13.
Peptide sequence FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SLC22A13 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
61 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for SLC22A13 Antibody - BSA Free
Background
SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-28 DA629093.1 1-28 29-485 AB010438.1 1-457 486-1375 BC035973.1 486-1375 1376-1554 AB010438.1 1348-1526 1555-2555 BC035973.1 1533-2533
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for SLC22A13 Antibody (NBP1-62520) (0)
There are no publications for SLC22A13 Antibody (NBP1-62520).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC22A13 Antibody (NBP1-62520) (0)
There are no reviews for SLC22A13 Antibody (NBP1-62520).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC22A13 Antibody (NBP1-62520) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC22A13 Products
Blogs on SLC22A13