SLC17A1/NPT Antibody

Images

 
Western Blot: SLC17A1/NPT Antibody [NBP2-83538] - Host: Rabbit. Target Name: SLC17A1. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC17A1/NPT Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC17A1/NPT. Peptide sequence: VHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNW The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC17A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC17A1/NPT Antibody

  • sodium-dependent phosphate transport protein 1
  • Na/Pi-4
  • NAPI-1
  • NPT1
  • NPT-1
  • SLC17A1
  • solute carrier family 17 (sodium phosphate), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42216
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-32252
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1923
Species: Ce
Applications: IHC, IHC-P, IP, WB
NBP1-05054
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00116085-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-60072
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
H00010786-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00006575-M04
Species: Hu, Mu
Applications: ELISA, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP1-87243
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
2629-FG/CF
Species: Mu
Applications: BA
NBP2-31030
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32499
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-83538
Species: Hu
Applications: WB

Publications for SLC17A1/NPT Antibody (NBP2-83538) (0)

There are no publications for SLC17A1/NPT Antibody (NBP2-83538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC17A1/NPT Antibody (NBP2-83538) (0)

There are no reviews for SLC17A1/NPT Antibody (NBP2-83538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC17A1/NPT Antibody (NBP2-83538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC17A1/NPT Products

Bioinformatics Tool for SLC17A1/NPT Antibody (NBP2-83538)

Discover related pathways, diseases and genes to SLC17A1/NPT Antibody (NBP2-83538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC17A1/NPT Antibody (NBP2-83538)

Discover more about diseases related to SLC17A1/NPT Antibody (NBP2-83538).
 

Pathways for SLC17A1/NPT Antibody (NBP2-83538)

View related products by pathway.

PTMs for SLC17A1/NPT Antibody (NBP2-83538)

Learn more about PTMs related to SLC17A1/NPT Antibody (NBP2-83538).

Blogs on SLC17A1/NPT

There are no specific blogs for SLC17A1/NPT, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC17A1/NPT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC17A1