Home » SLC17A1/NPT » SLC17A1/NPT Antibodies » SLC17A1/NPT Antibody

SLC17A1/NPT Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SLC17A1/NPT Antibody [NBP2-83538] - Host: Rabbit. Target Name: SLC17A1. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: SLC17A1/NPT Antibody [NBP2-83538] - Host: Rabbit. Target Name: SLC17A1. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SLC17A1/NPT Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC17A1/NPT. Peptide sequence: VHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNW The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC17A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC17A1/NPT Antibody

  • sodium-dependent phosphate transport protein 1
  • Na/Pi-4
  • NAPI-1
  • NPT1
  • NPT-1
  • SLC17A1
  • solute carrier family 17 (sodium phosphate), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SLC34A1 Antibody
(10B1.3E9) - BSA Free
NBP2-42216
Flow Cytometry: SLC34A1 Antibody (10B1.3E9) [NBP2-42216] - An intracellular stain was performed on Hek293 cells with SLC34A1 Antibody [10B1.3E9] NBP2-42216AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: SLC34A1 Antibody (10B1.3E9) [NBP2-42216] - An intracellular stain was performed on Hek293 cells with SLC34A1 Antibody [10B1.3E9] NBP2-42216APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin.
Flow Cytometry: SLC34A1 Antibody (10B1.3E9) [NBP2-42216] - An intracellular stain was performed on Hek293 cells with SLC34A1 Antibody [10B1.3E9] NBP2-42216PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
SLC20A1 Antibody
NBP1-32252
Western Blot: SLC20A1 Antibody [NBP1-32252] - Unboiled U87-MG cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with SLC20A1 antibody [N3C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody. (WCE: whole cell extract; ME: membrane extract)
Immunohistochemistry-Paraffin: SLC20A1 Antibody [NBP1-32252] - Paraffin-embedded mouse mammary gland. SLC20A1 antibody [N3C2], Internal diluted at 1:500.
Immunohistochemistry-Paraffin: SLC20A1 Antibody [NBP1-32252] - Paraffin-embedded AGS xenograft. SLC20A1 antibody [N3C2], Internal dilution: 1:500.
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - A. 30 ug A549 whole cell lysate/extract B. 30 ug HCT116 whole cell lysate/extract12 % SDS-PAGE GSTP1 antibody dilution: 1:5000
Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Paraffin-embedded rat fore brain dilution: 1:500.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Serpin A1/alpha
1-Antitrypsin Antibod
NBP1-90309
Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis in human plasma.
Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis using Anti-SERPINA1 antibody NBP1-90309 (A) shows similar pattern to independent antibody NBP1-90308 (B).
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cerebral cortex, kidney, placenta and testis using Anti-SERPINA1 antibody NBP1-90309 (A) shows similar protein distribution across tissues to independent antibody NBP1-90308 (B).
(9 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Sir2.1 Antibody
NB100-1923
Western Blot: Sir2.1 Antibody [NB100-1923] - Western blot using NB100-1923 against His tagged SIR-2.1 full-length protein.
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
GLUT9 Antibody -
BSA Free
NBP1-05054
Immunohistochemistry: GLUT9 Antibody [NBP1-05054] - Immunofluorescence staining of GLUT9 in PFA-fixed murine brain sections. Frozen sections of paraformaldehyde-fixed wild-type murine brain were used for immunofluorescence staining. a, b Antigen absorption test. Immunofluorescence staining of the ependymal wall of the dorsal third ventricle using a anti-GLUT9 antibody and b antigen-preabsorbed antibody. Scale bar 100 um. c, d Immunofluorescence staining of GLUT9 (magenta), acetylated-tubulin (Ac-Tubulin, green) and DAPI (blue) on ependymal cells. Scale bar 10 um. e-g Immunofluorescence staining of GLUT9 (magenta) and NeuN (green) showing co-localization in neurons. Scale bar 10 um. Image collected and cropped by CiteAb from the following publication (https://fluidsbarrierscns.biomedcentral.com/articles/10.1186/s12987-016-0046-x) licensed under a CC-BY licence.
Immunohistochemistry: GLUT9 Antibody [NBP1-05054] - GLUT9 in methacarn-fixed murine brain. Paraffin sections of methacarn-fixed murine brain were used for immunostaining. a, b Antigen absorption test. Immunohistochemistry using showing a anti-GLUT9 antibody staining in the third ventricle ependyma and parenchyma and b antigen-preabsorbed antibody. Scale bar 100 um. c GLUT9 immunoreactivity observed in brain capillaries in the cortex. Scale bar 100 um. d-f Immunofluorescence staining of d GLUT9 and e P-gp showing co-localization in capillaries. Blue indicates DAPI-stained nucleus of the brain capillary endothelial cell. Scale bar 10 um.Image collected and cropped by CiteAb from the following publication (https://fluidsbarrierscns.biomedcentral.com/articles/10.1186/s12987-016-0046-x) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: GLUT9 Antibody [NBP1-05054] - IHC-P analysis of mouse kidney section using GLUT9 antibody at 1:200 dilution. This antibody generated an expected cytoplasmic staining in tubular cells with a more staining towards membranes in some cells but no immunopositivity in Bowmans capsules.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SLC22A12 Antibody
(2B5)
H00116085-M02
Western Blot: SLC22A12 Antibody (2B5) [H00116085-M02] - SLC22A12 monoclonal antibody (M02), clone 2B5. Analysis of SLC22A12 expression in human stomach.
ELISA: SLC22A12 Antibody (2B5) [H00116085-M02] - Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
SLC17A2 Antibody
NBP1-60072
Western Blot: SLC17A2 Antibody [NBP1-60072] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: SLC17A2 Antibody [NBP1-60072] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu
Applications: IHC, IHC-P, WB
HNF1 Antibody
NBP1-33596
Western Blot: HNF1 Antibody [NBP1-33596] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with HNF1 alpha antibody [N1N3] diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: HNF1 Antibody [NBP1-33596] - Analysis. Mouse tissue extracts (50 Ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with HNF1 alpha antibody [N1N3] diluted at 1:2000.
Western Blot: HNF1 Antibody [NBP1-33596] - Rat tissue extracts (50 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with HNF1 alpha antibody [N1N3] diluted at 1:1000.
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Recombinant Human
SLC17A3 GST (N-Term) ...
H00010786-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
SLC20A2 Antibody
(4B1)
H00006575-M04
ELISA: SLC20A2 Antibody (4B1) [H00006575-M04] - Detection limit for recombinant GST tagged SLC20A2 is 0.3 ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, WB
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Immunocytochemistry/Immunofluorescence: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human kidney shows moderate to strong nuclear positivity in renal tubules.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
ABCG2/CD338
Antibody (3G8) - BSA
NBP2-22124
ELISA: ABCG2/CD338 Antibody (3G8) [NBP2-22124] - Red: Control Antigen (100ng), Purple: Antigen (10ng), Green: Antigen (50ng), Blue: Antigen (100ng).
Flow Cytometry: ABCG2/CD338 Antibody (3G8) [NBP2-22124] - Analysis of HepG2 cells using ABCG2 mouse mAb (green) and negative control (purple).
Immunocytochemistry/Immunofluorescence: ABCG2/CD338 Antibody (3G8) [NBP2-22124] - Analysis of Hela cells using ABCG2 mouse mAb (green). DRAQ5 fluorescent DNA dye (blue). Actin filaments have been labeled with Alexa Fluor-555 phalloidin (red).
(6 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
PTH was detected in immersion fixed paraffin-embedded sections of human parathyroid gland using Mouse Anti-Human PTH Monoclonal Antibody (Catalog # MAB7665) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human parathyroid tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human PTH Monoclonal Antibody (Catalog # MAB7665) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PTH at approximately 12 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IHC, WB
NAPRT1 Antibody
NBP1-87243
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87243] - Staining of human colon, kidney, lymph node and urinary bladder using Anti-NAPRT antibody NBP1-87243 (A) shows similar protein distribution across tissues to independent antibody NBP1-87244 (B).
Western Blot: NAPRT1 Antibody [NBP1-87243] - Analysis using Anti-NAPRT antibody NBP1-87243 (A) shows similar pattern to independent antibody NBP1-87244 (B).
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87243] - Analysis in human small intestine and skeletal muscle tissues using NBP1-87243 antibody. Corresponding NAPRT RNA-seq data are presented for the same tissues.
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
FGF-23
2629-FG/CF
FGF-23
(24 Publications)
Species: Mu
Applications: BA
SLC16A9 Antibody
NBP2-31030
Immunocytochemistry/Immunofluorescence: SLC16A9 Antibody [NBP2-31030] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus.
Immunohistochemistry-Paraffin: SLC16A9 Antibody [NBP2-31030] - Staining of human cervix shows weak membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SLC16A9 Antibody [NBP2-31030] - Staining of human endometrium shows moderate positivity in apical membrane in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Western Blot: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis using Anti-PAH antibody NBP2-48615 (A) shows similar pattern to independent antibody NBP1-80917 (B).
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis in human liver and pancreas tissues. Corresponding Phenylalanine Hydroxylase RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Species: Hu
Applications: IHC, IHC-P, WB
SLC25A33 Antibody
NBP1-32499
Western Blot: SLC25A33 Antibody [NBP1-32499] - Sample(30 ug whole cell lysate)A: 293TB: A431 C: H1299D: HeLa S3 E: Hep G2F: MOLT4 G: Raji 10% SDS PAGE diluted at 1:1000
Immunohistochemistry-Paraffin: SLC25A33 Antibody [NBP1-32499] - Paraffin-embedded SAOS-2 xenograft, using antibody at 1:500 dilution.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
SLC17A1/NPT
Antibody
NBP2-83538
SLC17A1/NPT Antibody
Species: Hu
Applications: WB

Publications for SLC17A1/NPT Antibody (NBP2-83538) (0)

There are no publications for SLC17A1/NPT Antibody (NBP2-83538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC17A1/NPT Antibody (NBP2-83538) (0)

There are no reviews for SLC17A1/NPT Antibody (NBP2-83538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC17A1/NPT Antibody (NBP2-83538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC17A1/NPT Products

Bioinformatics Tool for SLC17A1/NPT Antibody (NBP2-83538)

Discover related pathways, diseases and genes to SLC17A1/NPT Antibody (NBP2-83538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC17A1/NPT Antibody (NBP2-83538)

Discover more about diseases related to SLC17A1/NPT Antibody (NBP2-83538).
 

Pathways for SLC17A1/NPT Antibody (NBP2-83538)

View related products by pathway.

PTMs for SLC17A1/NPT Antibody (NBP2-83538)

Learn more about PTMs related to SLC17A1/NPT Antibody (NBP2-83538).

Blogs on SLC17A1/NPT

There are no specific blogs for SLC17A1/NPT, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC17A1/NPT Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC17A1