SLC17A2 Antibody

Images

 
Western Blot: SLC17A2 Antibody [NBP1-60072] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: SLC17A2 Antibody [NBP1-60072] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC17A2 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC17A2 (solute carrier family 17 (sodium phosphate), member 2) The peptide sequence was selected from the middle region of SLC17A2. Peptide sequence VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIF. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC17A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLC17A2 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC17A2 Antibody

  • MGC138238
  • NPT3member 2
  • solute carrier family 17 (sodium phosphate), member 2

Background

SLC17A2 is a member of the solute carrier family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42216
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
8090-ZN
Species: Hu
Applications: EnzAct
NBP1-32252
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NB300-536
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00006575-M04
Species: Hu, Mu
Applications: ELISA, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
H00010786-P01
Species: Hu
Applications: ELISA, AP, PA, WB
2629-FG/CF
Species: Mu
Applications: BA
NBP1-85495
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-81933
Species: Hu
Applications: IHC, IHC-P
NBP2-35224
Species: Hu
Applications: Func, PAGE

Publications for SLC17A2 Antibody (NBP1-60072) (0)

There are no publications for SLC17A2 Antibody (NBP1-60072).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC17A2 Antibody (NBP1-60072) (0)

There are no reviews for SLC17A2 Antibody (NBP1-60072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC17A2 Antibody (NBP1-60072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC17A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC17A2