SLC13A5 Antibody - BSA Free

Western Blot: SLC13A5 Antibody [NBP2-85736] - Host: Rabbit. Target Name: SLC13A5. Sample Type: Thymus Tumor lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC13A5 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SLC13A5. Peptide sequence: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC13A5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC13A5 Antibody - BSA Free

• DKFZp686E17257
• Na(+)/citrate cotransporter
• NaCT
• NACTMGC138356
• SLC13A5
• Sodium-coupled citrate transporter
• Sodium-dependent citrate transporter
• solute carrier family 13 (sodium-dependent citrate transporter), member 5
• solute carrier family 13 member 5
• solute carrier family 13, member 5

Background

SLC13A5 - solute carrier family 13 (sodium-dependent citrate transporter), member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC13A5