SLC12A3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC12A3 Antibody [NBP1-86376] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli, cytoplasm and centrosome.
Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC12A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC12A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC12A3 Protein (NBP1-86376PEP)
Publications
Read Publication using NBP1-86376.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC12A3 Antibody

  • FLJ96318
  • Na-Cl symporter
  • NCC
  • NCCT
  • SLC12A3
  • solute carrier family 12 (sodium/chloride transporters), member 3
  • solute carrier family 12 member 3
  • thiazide-sensitive Na-Cl cotransporter
  • Thiazide-sensitive sodium-chloride cotransporter
  • TSC
  • TSCNaCl electroneutral thiazide-sensitive cotransporter

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-46234
Species: Hu
Applications: WB, IHC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00001188-P01
Species: Hu
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82492
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-86376
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SLC12A3 Antibody (NBP1-86376)(1)

Reviews for SLC12A3 Antibody (NBP1-86376) (0)

There are no reviews for SLC12A3 Antibody (NBP1-86376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC12A3 Antibody (NBP1-86376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC12A3 Products

Bioinformatics Tool for SLC12A3 Antibody (NBP1-86376)

Discover related pathways, diseases and genes to SLC12A3 Antibody (NBP1-86376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC12A3 Antibody (NBP1-86376)

Discover more about diseases related to SLC12A3 Antibody (NBP1-86376).
 

Pathways for SLC12A3 Antibody (NBP1-86376)

View related products by pathway.

PTMs for SLC12A3 Antibody (NBP1-86376)

Learn more about PTMs related to SLC12A3 Antibody (NBP1-86376).

Blogs on SLC12A3

There are no specific blogs for SLC12A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC12A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A3
Entrez