SLC10A5 Antibody


Western Blot: SLC10A5 Antibody [NBP1-59707] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: SLC10A5 Antibody [NBP1-59707] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SLC10A5 Antibody Summary

Synthetic peptides corresponding to SLC10A5(solute carrier family 10 (sodium/bile acid cotransporter family), member 5) The peptide sequence was selected from the C terminal of SLC10A5. Peptide sequence GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC10A5 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC10A5 Antibody

  • Na(+)/bile acid cotransporter 5
  • P5
  • sodium/bile acid cotransporter 5
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 5
  • Solute carrier family 10 member 5


SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC10A5 Antibody (NBP1-59707) (0)

There are no publications for SLC10A5 Antibody (NBP1-59707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC10A5 Antibody (NBP1-59707) (0)

There are no reviews for SLC10A5 Antibody (NBP1-59707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC10A5 Antibody (NBP1-59707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SLC10A5 Products

Bioinformatics Tool for SLC10A5 Antibody (NBP1-59707)

Discover related pathways, diseases and genes to SLC10A5 Antibody (NBP1-59707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC10A5 Antibody (NBP1-59707)

Discover more about diseases related to SLC10A5 Antibody (NBP1-59707).

Pathways for SLC10A5 Antibody (NBP1-59707)

View related products by pathway.

Blogs on SLC10A5

There are no specific blogs for SLC10A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC10A5 Antibody and receive a gift card or discount.


Gene Symbol SLC10A5