SKOR2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SKOR2 Antibody [NBP2-14565] - Null and Hypomorphic Foxc1 mutations caused posterior cerebellar foliation defects due to mismigration of cells destined to form the posterior ...read more
Immunohistochemistry-Paraffin: SKOR2 Antibody [NBP2-14565] - Staining of mouse epididymis shows strong nuclear positivity in spermatozoa.
Immunohistochemistry-Paraffin: SKOR2 Antibody [NBP2-14565] - Staining of mouse cerebellum shows strong nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: SKOR2 Antibody [NBP2-14565] - Staining of mouse embryo E11 shows strong nuclear positivity in the developing cerebellum.
Immunohistochemistry-Paraffin: SKOR2 Antibody [NBP2-14565] - Staining of mouse heart shows no positivity in cardiomyocytes as expected.
Null and Hypomorphic Foxc1 mutations caused posterior cerebellar foliation defects due to mismigration of cells destined to form the posterior vermis. None of the mutant internal tdTomato+ cells were Sox9+ (K,k), ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SKOR2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVS
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKOR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/20898), licensed under a CC-BY licence.
Control Peptide
SKOR2 Recombinant Protein Antigen (NBP2-14565PEP)
Publications
Read Publications using
NBP2-14565 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKOR2 Antibody

  • CORL2
  • FUSSEL18
  • SKOR2 SKI family transcriptional corepressor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03881
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
MAB8398
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-13294
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00253738-M05
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-83090
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77305
Species: Hu
Applications: ELISA, ICC/IF, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
464-SH/CF
Species: Mu
Applications: BA
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83837
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13957
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89930
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-14565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for SKOR2 Antibody (NBP2-14565)(3)

Reviews for SKOR2 Antibody (NBP2-14565) (0)

There are no reviews for SKOR2 Antibody (NBP2-14565). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SKOR2 Antibody (NBP2-14565) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SKOR2 Products

Array NBP2-14565

Pathways for SKOR2 Antibody (NBP2-14565)

View related products by pathway.

Blogs on SKOR2

There are no specific blogs for SKOR2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKOR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SKOR2