SKI Antibody

Images

 
Western Blot: SKI Antibody [NBP2-56661] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SKI Antibody [NBP2-56661] - Staining of human cell line CACO-2 shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SKI Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESRE
Specificity
Specificity of human SKI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKI
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SKI Recombinant Protein Antigen (NBP2-56661PEP)

Reactivity Notes

Mouse 85%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SKI Antibody

  • C-ski
  • Proto-oncogene c-Ski
  • ski oncogene
  • ski oncoprotein
  • SKV
  • v-ski avian sarcoma viral oncogene homolog
  • v-ski sarcoma viral oncogene homolog (avian)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-56479
Species: Hu, Mu, Rt, Po, Bv, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24951
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
NBP1-90266
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
H00008877-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56163
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, IP
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56661
Species: Hu
Applications: WB, ICC/IF

Publications for SKI Antibody (NBP2-56661) (0)

There are no publications for SKI Antibody (NBP2-56661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKI Antibody (NBP2-56661) (0)

There are no reviews for SKI Antibody (NBP2-56661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SKI Antibody (NBP2-56661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SKI Products

Bioinformatics Tool for SKI Antibody (NBP2-56661)

Discover related pathways, diseases and genes to SKI Antibody (NBP2-56661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKI Antibody (NBP2-56661)

Discover more about diseases related to SKI Antibody (NBP2-56661).
 

Pathways for SKI Antibody (NBP2-56661)

View related products by pathway.

PTMs for SKI Antibody (NBP2-56661)

Learn more about PTMs related to SKI Antibody (NBP2-56661).

Blogs on SKI.

Winter Protein Games
Get into the Winter Protein Games 2014! Check out the contenders competing including SKI, POLE, ICEBURG, SKT, TRAIL, WIN and BOB1. Learn more about each protein's function, gene name, molecular weight and family.View all the fun and games happening...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SKI