![Western Blot: SKI Antibody [NBP2-56661] - Analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/SKI Antibody-Western Blot-NBP2-56661-img0002.jpg "Western Blot: SKI Antibody [NBP2-56661] - Analysis in human cell line RT-4 and human cell line U-251 MG.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESRE |
| Specificity | Specificity of human SKI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SKI |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for SKI Antibody (NBP2-56661)Discover more about diseases related to SKI Antibody (NBP2-56661).
| Pathways for SKI Antibody (NBP2-56661)View related products by pathway.
|
PTMs for SKI Antibody (NBP2-56661)Learn more about PTMs related to SKI Antibody (NBP2-56661).
|
|
Winter Protein Games Get into the Winter Protein Games 2014! Check out the contenders competing including SKI, POLE, ICEBURG, SKT, TRAIL, WIN and BOB1. Learn more about each protein's function, gene name, molecular weight and family.View all the fun and games happening... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SKI |
![Immunocytochemistry/Immunofluorescence: SKI Antibody [NBP2-56661] - Staining of human cell line CACO-2 shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/SKI-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56661-img0001.jpg "Immunocytochemistry/Immunofluorescence: SKI Antibody [NBP2-56661] - Staining of human cell line CACO-2 shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.")
![Western Blot: SnoN Antibody [NBP1-77306] - Analysis of SnoN in A431 cell lysate with SnoN antibody at (A) 0.5 and (B) 1 ug/mL.](http://images.novusbio.com/images2/SnoN-Antibody-Western-Blot-NBP1-77306-img0003.jpg)
![Immunohistochemistry-Paraffin: SnoN Antibody [NBP1-77306] - Mouse lung tissue with SnoN antibody at 5 ug/ml.](http://images.novusbio.com/images2/SnoN-Antibody-Immunohistochemistry-Paraffin-NBP1-77306-img0002.jpg)
![Immunofluorescence: SnoN Antibody [NBP1-77306] - Immunofluorescence of SnoN in Mouse Lung cells with SnoN antibody at 20 ug/mL.](http://images.novusbio.com/images2/SnoN-Antibody-Immunofluorescence-NBP1-77306-img0005.jpg)
![Western Blot: Smad3 Antibody [NB100-56479] - Analysis in human fibroblast and HeLa whole cell lysates. Untreated lysates show a band around 55 Kda. 1:1000 dilution, 1 hour blocking in milk 5%. Image from a verified customer review.](http://images.novusbio.com/images2/Smad3-Antibody-Western-Blot-NB100-56479-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Smad3 Antibody [NB100-56479] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Smad3 at 10 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/Smad3-Antibody-Immunocytochemistry-Immunofluorescence-NB100-56479-img0006.jpg)
![Immunohistochemistry-Paraffin: Smad3 Antibody [NB100-56479] - Human liver tissue probed with SMAD3 antibody (bottom left, right) and isotype control antibody (top left) at 10 ug/ml.](http://images.novusbio.com/images2/Smad3-Antibody-Immunohistochemistry-Paraffin-NB100-56479-img0004.jpg)
![Western Blot: SMAD4 Antibody [NBP2-24951] - Analysis using SMAD4 antibody. Lysate from A549 cells probed with SMAD4 antibody at 2 ug/ml.](http://images.novusbio.com/images2/SMAD4 Antibody-Western Blot-NBP2-24951-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Smad4 Antibody [NBP2-24951] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-SMAD4 Antibody NBP2-24951 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.](http://images.novusbio.com/images2/Smad4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-24951-img0003.jpg)
![Immunohistochemistry-Paraffin: Smad4 Antibody [NBP2-24951] - Analysis of a FFPE tissue section of human colon using 1:200 dilution of SMAD4 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Apical cytoplasmic staining was observed in both glandular and epithelial cells.](http://images.novusbio.com/images2/Smad4-Antibody-Immunohistochemistry-Paraffin-NBP2-24951-img0002.jpg)
![Western Blot: SBNO1 Antibody [NBP1-83837] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/images2/SBNO1-Antibody-Western-Blot-NBP1-83837-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: SBNO1 Antibody [NBP1-83837] - Staining of human cell line A549 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/images2/SBNO1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83837-img0008.jpg)
![Immunohistochemistry-Paraffin: SBNO1 Antibody [NBP1-83837] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/images2/SBNO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83837-img0012.jpg)
![Western Blot: SNW1 Antibody [NBP1-88523] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/images2/SNW1-Antibody-Western-Blot-NBP1-88523-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: SNW1 Antibody [NBP1-88523] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/images2/SNW1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88523-img0006.jpg)
![Immunohistochemistry-Paraffin: SNW1 Antibody [NBP1-88523] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/images2/SNW1-Antibody-Immunohistochemistry-Paraffin-NBP1-88523-img0012.jpg)
![Western Blot: NCOR1 Antibody [NB100-58824] - Whole cell lysate (50 ug) from HEK293T, K-562, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-NCoR antibodyused for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3minutes.](http://images.novusbio.com/images2/NCOR1-Antibody-Western-Blot-NB100-58824-img0002.jpg)
![Chromatin Immunoprecipitation Sequencing: NCOR1 Antibody [NB100-58824] - Localization of NCoR Binding Sites by ChIP-sequencing. Chromatin from K562 cells was immunoprecipitated with anti-NCoR antibody NB100-58824 and analyzed by DNA sequencing. The figure illustrates the peak distribution of NCoR binding within a 650 Kb region of the human X chromosome as detected using anti-NCoR antibody NB100-58824. ChIP-seq validation performed by Diogenode, Denville, NJ.](http://images.novusbio.com/images2/NCOR1 Antibody-Chromatin Immunoprecipitation Sequencing-NB100-58824-img0003.jpg)
![Immunoprecipitation: NCOR1 Antibody [NB100-58824] - Detection of Human NCOR on HeLa whole cell lysate using NB100-5882. NCOR was also immunoprecipitated by rabbit anti-NCOR antibody NB100-58825.](http://images.novusbio.com/images2/NCOR1-Antibody-Immunoprecipitation-NB100-58824-img0001.jpg)
![Western Blot: ATP Citrate Lyase Antibody [NBP1-90266] - Analysis using Anti-ACLY antibody NBP1-90266 (A) shows similar pattern to independent antibody NBP1-90268 (B).](http://images.novusbio.com/images2/ATP-Citrate-Lyase-Antibody-Western-Blot-NBP1-90266-img0010.jpg)
![Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90266] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/images2/ATP-Citrate-Lyase-Antibody-Immunohistochemistry-Paraffin-NBP1-90266-img0019.jpg)
![Western Blot: ATP Citrate Lyase Antibody [NBP1-90266] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ACLY antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/images2/ATP-Citrate-Lyase-Antibody-Western-Blot-NBP1-90266-img0007.jpg)
![Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).](http://images.novusbio.com/images2/p21-CIP1-CDKN1A-Antibody-(WA-1-(HJ21))-Immunohistochemistry-Paraffin-NBP2-29463-img0001.jpg)
![Western Blot: RNF111 Antibody (1C4) [H00054778-M05] - Analysis of RNF111 expression in transfected 293T cell line by RNF111 monoclonal antibody (M05), clone 1C4. Lane 1: RNF111 transfected lysatE (107.8 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/RNF111 Antibody (1C4)-Western Blot-H00054778-M05-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: RNF111 Antibody (1C4) [H00054778-M05] - Analysis of monoclonal antibody to RNF111 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/RNF111-Antibody-(1C4)-Immunocytochemistry-Immunofluorescence-H00054778-M05-img0003.jpg)
![Western Blot: RNF111 Antibody (1C4) [H00054778-M05] - Western blot analysis of RNF111 over-expressed 293 cell line, cotransfected with RNF111 Validated Chimera RNAi or non-transfected control. Blot probed with H00054778-M05. GAPDH (36.1 kDa) used as loading control.](http://images.novusbio.com/images2/RNF111-Antibody-(1C4)-Western-Blot-H00054778-M05-img0002.jpg)
![Western Blot: Sphingosine Kinase 1/SPHK1 Antibody (1D6) [H00008877-M01] - SPHK1 monoclonal antibody (M01), clone 1D6. Analysis of SPHK1 expression in K-562.](http://images.novusbio.com/images2/Sphingosine-Kinase-1-SPHK1-Antibody-(1D6)-Western-Blot-H00008877-M01-img0005.jpg)
![Western Blot: Sphingosine Kinase 1/SPHK1 Antibody (1D6) [H00008877-M01] - SPHK1 monoclonal antibody (M01), clone 1D6 Western Blot analysis of SPHK1 expression in A-431 ( Cat # L015V1 ).](http://images.novusbio.com/images2/Sphingosine-Kinase-1-SPHK1-Antibody-(1D6)-Western-Blot-H00008877-M01-img0002.jpg)
![Western Blot: Sphingosine Kinase 1/SPHK1 Antibody (1D6) [H00008877-M01] - Analysis of SPHK1 expression in transfected 293T cell line by SPHK1 monoclonal antibody (M01), clone 1D6.Lane 1: SPHK1 transfected lysate(43.9 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/Sphingosine Kinase 1-SPHK1 Antibody (1D6)-Western Blot-H00008877-M01-img0006.jpg)
![Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Western-Blot-NBP2-24916-img0001.jpg)
![Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Immunohistochemistry-Paraffin-NBP2-24916-img0002.jpg)
![Western Blot: Chromogranin B Antibody [NBP1-80782] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Adrenal Gland tissue](http://images.novusbio.com/images2/Chromogranin-B-Antibody-Western-Blot-NBP1-80782-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Chromogranin B Antibody [NBP1-80782] - Staining of human cell line SH-SY5Y shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/Chromogranin-B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80782-img0006.jpg)
![Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.](http://images.novusbio.com/images2/Chromogranin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-80782-img0019.jpg)
![Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/CRAT-Antibody-Immunohistochemistry-Paraffin-NBP1-86616-img0014.jpg)
![Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).](http://images.novusbio.com/images2/CRAT-Antibody-Western-Blot-NBP1-86616-img0011.jpg)
![Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.](http://images.novusbio.com/images2/CRAT-Antibody-Western-Blot-NBP1-86616-img0010.jpg)
![Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.](http://images.novusbio.com/images2/GLYAT-Antibody-Western-Blot-NBP2-58917-img0002.jpg)
![Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.](http://images.novusbio.com/images2/GLYAT Antibody-Immunohistochemistry-Paraffin-NBP2-58917-img0010.jpg)
![Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.](http://images.novusbio.com/images2/GLYAT-Antibody-Immunohistochemistry-Paraffin-NBP2-58917-img0004.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")