SKI Antibody

Western Blot: SKI Antibody [NBP2-56661] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: SKI Antibody [NBP2-56661] - Staining of human cell line CACO-2 shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.

Product Discontinued

SKI Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESRE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SKI
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 85%, Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SKI Antibody

• C-ski
• Proto-oncogene c-Ski
• ski oncogene
• ski oncoprotein
• SKI
• SKV
• v-ski avian sarcoma viral oncogene homolog
• v-ski sarcoma viral oncogene homolog (avian)

Background

The SKI gene encodes the nuclear protooncogene protein homolog of avian sarcoma viral (v-ski) oncogene. It functions as arepressor of TGF-beta signaling, and may play a role in neural tube development and muscle differentiation. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SKI