Home » SKI » SKI Antibodies » SKI Antibody

SKI Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SKI Antibody [NBP2-56661] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Western Blot: SKI Antibody [NBP2-56661] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SKI Antibody [NBP2-56661] - Staining of human cell line CACO-2 shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SKI Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESRE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKI
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SKI Recombinant Protein Antigen (NBP2-56661PEP)

Reactivity Notes

Mouse 85%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SKI Antibody

  • C-ski
  • Proto-oncogene c-Ski
  • ski oncogene
  • ski oncoprotein
  • SKI
  • SKV
  • v-ski avian sarcoma viral oncogene homolog
  • v-ski sarcoma viral oncogene homolog (avian)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SnoN Antibody
NBP1-77306
Immunofluorescence: SnoN Antibody [NBP1-77306] - HeLa cells stained with SnoN antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: SnoN Antibody [NBP1-77306] - Mouse lung tissue with SnoN antibody at 5 ug/ml.
Western Blot: SnoN Antibody [NBP1-77306] - Analysis of SnoN in A431 cell lysate with SnoN antibody at (A) 0.5 and (B) 1 ug/mL.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
Smad2/3 Antibody
[Unconjugated]
AF3797
Western blot shows lysates of A549 human lung carcinoma cell line, Jurkat human acute T cell leukemia cell line, HEK293 human embryonic kidney cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.5 µg/mL Goat Anti-Human/Mouse Smad2/3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3797) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human Smad2 and Smad3 were included. Specific bands for Smad2 were detected at approximately 64 and 58 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL PMA and 200 ng/mL calcium ionomycin for 30 minutes was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Smad2/3/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse Smad2/3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3797) or control antibody (Catalog # AB‑108‑C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The c-myc promoter was detected by standard PCR.
Smad2/3 was detected in immersion fixed MCF‑7 human breast cancer cell line induced (upper panel) or non-induced (lower panel) to undergo epithelial-mesenchymal transition (EMT) using Goat Anti-Human/Mouse Smad2/3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3797) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and, in EMT-induced cells, nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(14 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Smad3 Antibody
NB100-56479
Immunocytochemistry/Immunofluorescence: Smad3 Antibody [NB100-56479] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Smad3 at 10 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: Smad3 Antibody [NB100-56479] - Analysis in human fibroblast and HeLa whole cell lysates. Untreated lysates show a band around 55 kDa. 1:1000 dilution, 1 hour blocking in milk 5%. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Smad3 Antibody [NB100-56479] - Human liver tissue probed with SMAD3 antibody (bottom left, right) and isotype control antibody (top left) at 10 ug/mL.
(5 Reviews)
(6 Publications)
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Smad4 Antibody
NBP2-24951
Immunohistochemistry-Paraffin: Smad4 Antibody [NBP2-24951] - Analysis of a FFPE tissue section of human colon using 1:200 dilution of SMAD4 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Apical cytoplasmic staining was observed in both glandular and epithelial cells.
Immunocytochemistry/Immunofluorescence: Smad4 Antibody [NBP2-24951] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-SMAD4 Antibody NBP2-24951 at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Western Blot: Smad4 Antibody [NBP2-24951] - SMAD4 Antibody [NBP2-24951] - Analysis using SMAD4 antibody. Lysate from A549 cells probed with SMAD4 antibody at 2 ug/mL.
(3 Reviews)
(2 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: CyTOF-ready, Flow, WB
SBNO1 Antibody
NBP1-83837
Immunocytochemistry/Immunofluorescence: SBNO1 Antibody [NBP1-83837] - Staining of human cell line A549 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SBNO1 Antibody [NBP1-83837] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SBNO1 Antibody [NBP1-83837] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SNW1 Antibody
NBP1-88523
Western Blot: SNW1 Antibody [NBP1-88523] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: SNW1 Antibody [NBP1-88523] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SNW1 Antibody [NBP1-88523] - Staining of human liver shows strong nuclear positivity in hepatocytes.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NCOR1 Antibody
NB100-58824
Western Blot: NCOR1 Antibody [NB100-58824] - Whole cell lysate (50 ug) from HEK293T, K-562, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-NCoR antibodyused for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3minutes.
Immunoprecipitation: NCOR1 Antibody [NB100-58824] - Detection of Human NCOR on HeLa whole cell lysate using NB100-5882. NCOR was also immunoprecipitated by rabbit anti-NCOR antibody NB100-58825.
Chromatin Immunoprecipitation Sequencing: NCOR1 Antibody [NB100-58824] - Localization of NCoR Binding Sites by ChIP-sequencing. Chromatin from K562 cells was immunoprecipitated with anti-NCoR antibody NB100-58824 and analyzed by DNA sequencing. The figure illustrates the peak distribution of NCoR binding within a 650 Kb region of the human X chromosome as detected using anti-NCoR antibody NB100-58824. ChIP-seq validation performed by Diogenode, Denville, NJ.
(3 Publications)
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
ATP Citrate Lyase
Antibody
NBP1-90267
Immunocytochemistry/Immunofluorescence: ATP Citrate Lyase Antibody [NBP1-90267] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Western Blot: ATP Citrate Lyase Antibody [NBP1-90267] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ACLY antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western Blot: ATP Citrate Lyase Antibody [NBP1-90267] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Smad7 Antibody
(293039) [Unconjugate
MAB2029
Western blot shows lysates of H9 human cutaneous T lymphoma cell line, PT18 mouse mast/basophil cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat Smad7 Monoclonal Antibody (Catalog # MAB2029) followed by HRP‑conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Smad7 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Smad7 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using 25 µg/mL Human/Mouse/Rat Smad7 Monoclonal Antibody (Catalog # MAB2029) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Smad7 was detected in immersion fixed paraffin-embedded sections of human liver array using Human/Mouse/Rat Smad7 Monoclonal Antibody (Catalog # MAB2029) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(35 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
TGF-beta 1
[Unconjugated]
7754-BH/CF
Recombinant human TGF-beta 1 (7754-BH/CF) inhibits recombinant mouse IL-4 induced proliferation in the HT-2 mouse T cell line. The ED50 for this effect is 0.04-0.2 ng/mL.
(16 Publications)
Species: Hu
Applications: BA
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(16 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
RNF111 Antibody
(1C4)
H00054778-M05
ELISA: RNF111 Antibody (1C4) [H00054778-M05] - Detection limit for recombinant GST tagged RNF111 is 0.03 ng/ml as a capture antibody.
Western Blot: RNF111 Antibody (1C4) [H00054778-M05] - Western blot analysis of RNF111 over-expressed 293 cell line, cotransfected with RNF111 Validated Chimera RNAi or non-transfected control. Blot probed with H00054778-M05. GAPDH (36.1 kDa) used as loading control.
Immunocytochemistry/Immunofluorescence: RNF111 Antibody (1C4) [H00054778-M05] - Analysis of monoclonal antibody to RNF111 on HeLa cell. Antibody concentration 10 ug/ml
(11 Publications)
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
Sphingosine Kinase
1/SPHK1 Antibody (1D6 ...
H00008877-M01
ELISA: Sphingosine Kinase 1/SPHK1 Antibody (1D6) [H00008877-M01] - Detection limit for recombinant GST tagged SPHK1 is approximately 1ng/ml as a capture antibody.
Western Blot: Sphingosine Kinase 1/SPHK1 Antibody (1D6) [H00008877-M01] - SPHK1 monoclonal antibody (M01), clone 1D6 Western Blot analysis of SPHK1 expression in A-431 ( Cat # L015V1 ).
Western Blot: Sphingosine Kinase 1/SPHK1 Antibody (1D6) [H00008877-M01] - Analysis of SPHK1 expression in transfected 293T cell line by SPHK1 monoclonal antibody (M01), clone 1D6.Lane 1: SPHK1 transfected lysate(43.9 KDa).Lane 2: Non-transfected lysate.
(12 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Chromogranin B
Antibody
NBP1-80782
Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human adrenal gland, colon, liver and pancreas using Anti-CHGB antibody NBP1-80782 (A) shows similar protein distribution across tissues to independent antibody NBP1-80781 (B).
Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CRAT Antibody
NBP1-86615
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human tonsil shows low expression as expected.
Western Blot: CRAT Antibody [NBP1-86615] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
Semenogelin I
Antibody
NB100-56163
Semenogelin I Antibody
Species: Ma, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
SKI Antibody
NBP2-56661
SKI Antibody
Species: Hu
Applications: WB, ICC/IF

Publications for SKI Antibody (NBP2-56661) (0)

There are no publications for SKI Antibody (NBP2-56661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKI Antibody (NBP2-56661) (0)

There are no reviews for SKI Antibody (NBP2-56661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SKI Antibody (NBP2-56661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SKI Products

Bioinformatics Tool for SKI Antibody (NBP2-56661)

Discover related pathways, diseases and genes to SKI Antibody (NBP2-56661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKI Antibody (NBP2-56661)

Discover more about diseases related to SKI Antibody (NBP2-56661).
 

Pathways for SKI Antibody (NBP2-56661)

View related products by pathway.

PTMs for SKI Antibody (NBP2-56661)

Learn more about PTMs related to SKI Antibody (NBP2-56661).

Blogs on SKI.

Check out the latest blog posts on SKI.
Winter Protein Games
Get into the Winter Protein Games 2014! Check out the contenders competing including SKI, POLE, ICEBURG, SKT, TRAIL, WIN and BOB1. Learn more about each protein's function, gene name, molecular weight and family.View all the fun and games happening ...  Read full blog post.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKI Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SKI