SKAP55 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SKAP1. Source: E. coli
Amino Acid Sequence: SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SKAP1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87836. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SKAP55 Recombinant Protein Antigen
Background
Src kinase-associated phosphoprotein of 55 kDa (SKAP55) is expressed as a constitutively tyrosine phosphorylated 55-kD adapter protein that positively regulates TCR signaling. SKAP55 has also been shown to enhance adhesion to fibronectin and ICAM1, colocalize with F-actin at the T cell-antigen-presenting cell synapse and promotes the clustering of LFA1 and TCR ligation. TCR engagement induces the translocation of SKAP55 to lipid rafts, where the interactions with Fyn take place. CD45 also plays a very important role in SKAP55/TCR-mediated signaling. SKAP55 involvement in the TCR signaling pathway is the subject of current research in murine as well as human models.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: AC
Publications for SKAP55 Protein (NBP1-87836PEP) (0)
There are no publications for SKAP55 Protein (NBP1-87836PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SKAP55 Protein (NBP1-87836PEP) (0)
There are no reviews for SKAP55 Protein (NBP1-87836PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SKAP55 Protein (NBP1-87836PEP) (0)
Additional SKAP55 Products
Blogs on SKAP55