SKAP Antibody

Images

 
Orthogonal Strategies: Western Blot: SKAP Antibody [NBP1-94007] - Analysis in human cell lines A-431 and SK-MEL-30 using anti-KNSTRN antibody. Corresponding KNSTRN RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: SKAP Antibody [NBP1-94007] - Staining of human cell line A-431 shows localization to cytosol & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Orthogonal Strategies: Simple Western: SKAP Antibody [NBP1-94007] - SKAP Antibody [NBP1-94007] - Simple Western lane view shows a specific band for SKAP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. ...read more
Orthogonal Strategies: Simple Western: SKAP Antibody [NBP1-94007] - SKAP Antibody [NBP1-94007] - Electropherogram image(s) of corresponding Simple Western lane view. SKAP antibody was used at 1:20 dilution on ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SKAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KNSTRN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
SKAP Protein (NBP1-94007PEP)
Publications
Read Publications using NBP1-94007.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23891108).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKAP Antibody

  • C15orf23
  • chromosome 15 open reading frame 23
  • FLJ14502
  • HSD11
  • MGC141728
  • MGC141729
  • putative TRAF4-associated factor 1
  • SKAP
  • small kinetochore associated protein
  • TRAF4 associated factor 1
  • TRAF4AF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74638
Species: Hu
Applications: ICC/IF, IP, WB (-)
H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NBP2-37898
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-17099
Species: Hu
Applications: IHC, IHC-P
NBP2-00714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-76881
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84928
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92535
Species: Hu, Mu, Rt
Applications: WB
NBP1-21395
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008631-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
AF7024
Species: Hu, Mu
Applications: WB
AF8537
Species: Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-88302
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-94007
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for SKAP Antibody (NBP1-94007)(2)

Reviews for SKAP Antibody (NBP1-94007) (0)

There are no reviews for SKAP Antibody (NBP1-94007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SKAP Antibody (NBP1-94007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SKAP Products

Bioinformatics Tool for SKAP Antibody (NBP1-94007)

Discover related pathways, diseases and genes to SKAP Antibody (NBP1-94007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SKAP

There are no specific blogs for SKAP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KNSTRN