SKAP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SKAP Antibody [NBP1-94007] - Staining of human cell line A-431 shows localization to cytosol & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Orthogonal Strategies: Simple Western: SKAP Antibody [NBP1-94007] - SKAP Antibody [NBP1-94007] - Simple Western lane view shows a specific band for SKAP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. ...read more
Orthogonal Strategies: Simple Western: SKAP Antibody [NBP1-94007] - SKAP Antibody [NBP1-94007] - Electropherogram image(s) of corresponding Simple Western lane view. SKAP antibody was used at 1:20 dilution on ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Simple Western, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SKAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KNSTRN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
SKAP Protein (NBP1-94007PEP)
Publications
Read Publications using NBP1-94007.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23891108).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKAP Antibody

  • C15orf23
  • chromosome 15 open reading frame 23
  • FLJ14502
  • HSD11
  • MGC141728
  • MGC141729
  • putative TRAF4-associated factor 1
  • SKAP
  • small kinetochore associated protein
  • TRAF4 associated factor 1
  • TRAF4AF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74638
Species: Hu
Applications: ICC/IF, IP, WB (-)
H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NBP2-37898
Species: Hu
Applications: IHC, IHC-P, WB
AF877
Species: Hu
Applications: IHC, IP, WB
NBP3-17099
Species: Hu
Applications: IHC, IHC-P
NBP2-00714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15910
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84928
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92535
Species: Hu, Mu, Rt
Applications: WB
NBP1-21395
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008631-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
AF7024
Species: Hu, Mu
Applications: WB
AF8537
Species: Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-88302
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-94007
Species: Hu
Applications: Simple Western, ICC/IF, IHC

Publications for SKAP Antibody (NBP1-94007)(2)

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for SKAP Antibody (NBP1-94007) (0)

There are no reviews for SKAP Antibody (NBP1-94007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SKAP Antibody (NBP1-94007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KNSTRN