SKAP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SKAP Antibody [NBP1-94007] - Staining of human cell line A-431 shows localization to cytosol & microtubules. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Simple Western: SKAP Antibody [NBP1-94007] - SKAP Antibody [NBP1-94007] - Simple Western lane view shows a specific band for SKAP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: SKAP Antibody [NBP1-94007] - SKAP Antibody [NBP1-94007] - Electropherogram image(s) of corresponding Simple Western lane view. SKAP antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

• Reactivity: Hu
• Applications: Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SKAP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KNSTRN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:20
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 34 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  SKAP Protein (NBP1-94007PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23891108).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SKAP Antibody - BSA Free

• C15orf23
• chromosome 15 open reading frame 23
• FLJ14502
• HSD11
• MGC141728
• MGC141729
• putative TRAF4-associated factor 1
• SKAP
• small kinetochore associated protein
• TRAF4 associated factor 1
• TRAF4AF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SKAP Antibody (NBP1-94007)(2)

Publications using NBP1-94007

• Tamura N, Simon JE, Nayak A et al. A proteomic study of mitotic phase-specific interactors of EB1 reveals a role for SXIP-mediated protein interactions in anaphase onset. Biol Open 2015-01-16 [PMID: 25596275] (WB, ICC/IF)
• Shrestha RL, Draviam VM. Lateral to End-on Conversion of Chromosome-Microtubule Attachment Requires Kinesins CENP-E and MCAK. Curr Biol 2013-08-19 [PMID: 23891108]

Bioinformatics

• Gene Symbol: KNSTRN