SKA2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit SKA2 Antibody - BSA Free (NBP2-32443) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SKA2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (81%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SKA2 Antibody - BSA Free
Background
SKA2 has been identified as part of a spindle and kinetochore complex that contains at least one other protein, SKA1. The two proteins directly interact with each other. Both are required for proper mitotic progression. During prometaphase the complex associates with the kinetochores afer microtubule attachment. Data suggests that the complex is needed to maintain chromosome alignment along the metaphase plate and for checkpoint signaling.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Ha, Hu, Mar, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Publications for SKA2 Antibody (NBP2-32443) (0)
There are no publications for SKA2 Antibody (NBP2-32443).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SKA2 Antibody (NBP2-32443) (0)
There are no reviews for SKA2 Antibody (NBP2-32443).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SKA2 Antibody (NBP2-32443) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SKA2 Products
Blogs on SKA2