SKA2 Antibody

Images

 
Immunohistochemistry-Paraffin: SKA2 Antibody [NBP2-32443] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SKA2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SKA2 Protein (NBP2-32443PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKA2 Antibody

  • FAM33A
  • family with sequence similarity 33, member A
  • FLJ12758
  • MGC110975
  • spindle and kinetochore associated complex subunit 2
  • spindle and kinetochore-associated protein 2
  • spindle and KT (kinetochore) associated 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92391
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88398
Species: Hu
Applications: IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NB100-2586
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
AF4185
Species: Hu
Applications: ICC
NBP1-88302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
H00004223-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32443
Species: Hu
Applications: IHC, IHC-P

Publications for SKA2 Antibody (NBP2-32443) (0)

There are no publications for SKA2 Antibody (NBP2-32443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKA2 Antibody (NBP2-32443) (0)

There are no reviews for SKA2 Antibody (NBP2-32443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SKA2 Antibody (NBP2-32443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SKA2 Products

SKA2 NBP2-32443

Bioinformatics Tool for SKA2 Antibody (NBP2-32443)

Discover related pathways, diseases and genes to SKA2 Antibody (NBP2-32443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKA2 Antibody (NBP2-32443)

Discover more about diseases related to SKA2 Antibody (NBP2-32443).
 

Pathways for SKA2 Antibody (NBP2-32443)

View related products by pathway.

PTMs for SKA2 Antibody (NBP2-32443)

Learn more about PTMs related to SKA2 Antibody (NBP2-32443).

Blogs on SKA2

There are no specific blogs for SKA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SKA2