SKA2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SKA2 Antibody [NBP2-32443] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SKA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SKA2 Antibody - BSA Free (NBP2-32443) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SKA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SKA2 Protein (NBP2-32443PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SKA2 Antibody - BSA Free

• FAM33A
• family with sequence similarity 33, member A
• FLJ12758
• MGC110975
• spindle and kinetochore associated complex subunit 2
• spindle and kinetochore-associated protein 2
• spindle and KT (kinetochore) associated 2

Background

SKA2 has been identified as part of a spindle and kinetochore complex that contains at least one other protein, SKA1. The two proteins directly interact with each other. Both are required for proper mitotic progression. During prometaphase the complex associates with the kinetochores afer microtubule attachment. Data suggests that the complex is needed to maintain chromosome alignment along the metaphase plate and for checkpoint signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SKA2