SIX4 Antibody (7F1)

Images

 
Western Blot: SIX homeobox 4 Antibody (7F1) [H00051804-M02] - SIX4 monoclonal antibody (M02), clone 7F1 Analysis of SIX4 expression in Hela S3 NE.
Sandwich ELISA: SIX homeobox 4 Antibody (7F1) [H00051804-M02] - Detection limit for recombinant GST tagged SIX4 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
7F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SIX4 Antibody (7F1) Summary

Immunogen
SIX4 (NP_059116, 672 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD
Specificity
SIX4 (7F1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SIX4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SIX4 Antibody (7F1)

  • AREC3
  • homeobox protein SIX4
  • MGC119450
  • MGC119452
  • MGC119453
  • sine oculis homeobox (Drosophila) homolog 4
  • sine oculis homeobox homolog 4 (Drosophila)
  • Sine oculis homeobox homolog 4
  • SIX homeobox 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84264
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, KD, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-85009
Species: Hu, Mu
Applications: IHC, IHC-P
H00010736-M01
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, KD, WB
H00006496-M04
Species: Hu
Applications: ELISA, WB
NBP2-87382
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82478
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84026
Species: Hu
Applications: IHC, IHC-P, WB
MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
NBP1-52030
Species: Hu
Applications: PEP-ELISA, WB
AF3364
Species: Hu
Applications: ICC, IHC, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP2-13957
Species: Hu
Applications: IHC, IHC-P, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP1-85010
Species: Hu
Applications: IHC, IHC-P, WB
AF5045
Species: Hu, Mu
Applications: IHC, WB
NB300-750
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
H00051804-M02
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for SIX4 Antibody (H00051804-M02) (0)

There are no publications for SIX4 Antibody (H00051804-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIX4 Antibody (H00051804-M02) (0)

There are no reviews for SIX4 Antibody (H00051804-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIX4 Antibody (H00051804-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIX4 Products

Bioinformatics Tool for SIX4 Antibody (H00051804-M02)

Discover related pathways, diseases and genes to SIX4 Antibody (H00051804-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIX4 Antibody (H00051804-M02)

Discover more about diseases related to SIX4 Antibody (H00051804-M02).
 

Pathways for SIX4 Antibody (H00051804-M02)

View related products by pathway.

PTMs for SIX4 Antibody (H00051804-M02)

Learn more about PTMs related to SIX4 Antibody (H00051804-M02).

Blogs on SIX4

There are no specific blogs for SIX4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIX4 Antibody (7F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SIX4
Entrez
OMIM
Uniprot