Recombinant Human SIRT4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SIRT4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 215-314 of Human SIRT4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SIRT4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SIRT4 Protein

  • EC 2.4.2.-
  • EC 3.5.1
  • MGC130046
  • MGC130047
  • MGC57437
  • SIR2L4NAD-dependent ADP-ribosyltransferase sirtuin-4
  • sir2-like 4
  • SIR2-like protein 4
  • sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
  • sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 4
  • sirtuin 4
  • sirtuin type 4

Background

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-56372
Species: Hu, Mu, Rt
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-2522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-52565
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF5510
Species: Hu
Applications: WB
NBL1-11569
Species: Hu
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-07463
Species: Hu

Publications for SIRT4 Partial Recombinant Protein (H00023409-Q01) (0)

There are no publications for SIRT4 Partial Recombinant Protein (H00023409-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRT4 Partial Recombinant Protein (H00023409-Q01) (0)

There are no reviews for SIRT4 Partial Recombinant Protein (H00023409-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIRT4 Partial Recombinant Protein (H00023409-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIRT4 Products

Bioinformatics Tool for SIRT4 Partial Recombinant Protein (H00023409-Q01)

Discover related pathways, diseases and genes to SIRT4 Partial Recombinant Protein (H00023409-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIRT4 Partial Recombinant Protein (H00023409-Q01)

Discover more about diseases related to SIRT4 Partial Recombinant Protein (H00023409-Q01).
 

Pathways for SIRT4 Partial Recombinant Protein (H00023409-Q01)

View related products by pathway.

PTMs for SIRT4 Partial Recombinant Protein (H00023409-Q01)

Learn more about PTMs related to SIRT4 Partial Recombinant Protein (H00023409-Q01).
 

Research Areas for SIRT4 Partial Recombinant Protein (H00023409-Q01)

Find related products by research area.

Blogs on SIRT4

There are no specific blogs for SIRT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SIRT6 Antibody
NB100-2522
SIRT4 Antibody
NB100-1406

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SIRT4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRT4