SIN3A Recombinant Protein Antigen

Images

 
There are currently no images for SIN3A Protein (NBP2-38949PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SIN3A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIN3A.

Source: E.coli

Amino Acid Sequence: LDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIN3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38949.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SIN3A Recombinant Protein Antigen

  • DKFZp434K2235
  • FLJ90319
  • Histone deacetylase complex subunit Sin3a
  • KIAA0700
  • paired amphipathic helix protein Sin3a
  • SIN3 homolog A, transcription regulator (yeast)
  • SIN3 homolog A, transcriptional regulator (yeast)
  • SIN3A
  • Transcriptional corepressor Sin3a
  • transcriptional co-repressor Sin3A
  • transcriptional regulator, SIN3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP, ICC
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20367
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46522
Species: Hu
Applications: WB, IHC

Publications for SIN3A Protein (NBP2-38949PEP) (0)

There are no publications for SIN3A Protein (NBP2-38949PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIN3A Protein (NBP2-38949PEP) (0)

There are no reviews for SIN3A Protein (NBP2-38949PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SIN3A Protein (NBP2-38949PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP2-38949PEP

Bioinformatics Tool for SIN3A Protein (NBP2-38949PEP)

Discover related pathways, diseases and genes to SIN3A Protein (NBP2-38949PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIN3A Protein (NBP2-38949PEP)

Discover more about diseases related to SIN3A Protein (NBP2-38949PEP).
 

Pathways for SIN3A Protein (NBP2-38949PEP)

View related products by pathway.

PTMs for SIN3A Protein (NBP2-38949PEP)

Learn more about PTMs related to SIN3A Protein (NBP2-38949PEP).

Blogs on SIN3A

There are no specific blogs for SIN3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
SIN3A Antibody
NB600-1263-100ug
HDAC1 Antibody
NB100-56340

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIN3A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SIN3A
Entrez